Recombinant Human SULT1A3 protein, His-SUMO-tagged
Cat.No. : | SULT1A3-3544H |
Product Overview : | Recombinant Human SULT1A3 protein(P0DMM9)(1-295aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-295aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 50.2 kDa |
AA Sequence : | MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SULT1A3 sulfotransferase family, cytosolic, 1A, phenol-preferring, member 3 [ Homo sapiens ] |
Official Symbol | SULT1A3 |
Synonyms | SULT1A3; sulfotransferase family, cytosolic, 1A, phenol-preferring, member 3; STM; sulfotransferase 1A3/1A4; TL PST; sulfokinase; phenol sulfotransferase 1A5; aryl sulfotransferase 1A3/1A4; dopamine-specific sulfotransferase; placental estrogen sulfotransferase; monoamine-sulfating phenosulfotransferase; catecholamine-sulfating phenol sulfotransferase; thermolabile (monoamine, M form) phenol sulfotransferase; HAST; HAST3; M-PST; ST1A5; TL-PST; ST1A3/ST1A4; MGC117469; |
Gene ID | 6818 |
mRNA Refseq | NM_177552 |
Protein Refseq | NP_808220 |
MIM | 600641 |
UniProt ID | P50224 |
◆ Recombinant Proteins | ||
SULT1A3-7316H | Active Recombinant Human SULT1A3 protein(Glu2-Leu295), His-tagged | +Inquiry |
SULT1A3-89H | Active Recombinant Human SULT1A3 Protein | +Inquiry |
SULT1A3-112H | Recombinant Human SULT1A3 Protein, HIS-tagged | +Inquiry |
SULT1A3-6378H | Recombinant Human SULT1A3 Protein (Met1-Leu295), N-His tagged | +Inquiry |
SULT1A3-4374R | Recombinant Rhesus Macaque SULT1A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SULT1A3-1354HCL | Recombinant Human SULT1A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SULT1A3 Products
Required fields are marked with *
My Review for All SULT1A3 Products
Required fields are marked with *