Recombinant Human SULT1A4 protein, His-tagged
| Cat.No. : | SULT1A4-2691H |
| Product Overview : | Recombinant Human SULT1A4 protein(1-295 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | December 12, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-295 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | SULT1A4 |
| Synonyms | SULT1A4; sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4; GALPHA; MTDPS9; SUCLA1; succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial; SCS-alpha; succinyl-CoA synthetase subunit alpha; succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial; Aryl Sulfotransferase 1A3/1A4; Catecholamine-Sulfating Phenol Sulfotransferase; Monoamine-Sulfating Phenol Sulfotransferase; Placental Estrogen Sulfotransferase; Sulfotransferase, Monoamine-Preferring; Thermolabile Phenol Sulfotransferase; HAST3; M-PST; ST1A3/ST1A4; TL-PST; EC 2.8.2.1; sulfokinase; Sulfotransferase 1A3/1A4; STM; EC 2.8.2 |
| Gene ID | 445329 |
| mRNA Refseq | NM_001017390 |
| Protein Refseq | NP_001017390 |
| UniProt ID | P50224 |
| ◆ Recombinant Proteins | ||
| SULT1A4-3047H | Recombinant Human SULT1A4 protein, GST-tagged | +Inquiry |
| SULT1A4-583H | Recombinant Human SULT1A4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SULT1A4-4153H | Recombinant Human SULT1A4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SULT1A4-2873H | Recombinant Human SULT1A4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SULT1A4-2691H | Recombinant Human SULT1A4 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SULT1A4-1353HCL | Recombinant Human SULT1A4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SULT1A4 Products
Required fields are marked with *
My Review for All SULT1A4 Products
Required fields are marked with *
