Recombinant Human SULT1C2 protein, GST-tagged
Cat.No. : | SULT1C2-1823H |
Product Overview : | Recombinant Human SULT1C2 protein(1-296 aa), fused to GST tag, was expressed in E. coli. |
Availability | July 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-296 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SULT1C2 sulfotransferase family, cytosolic, 1C, member 2 [ Homo sapiens ] |
Official Symbol | SULT1C2 |
Synonyms | SULT1C2; sulfotransferase family, cytosolic, 1C, member 2; sulfotransferase family, cytosolic, 1C, member 1 , SULT1C1; sulfotransferase 1C2; ST1C1; SULT1C#1; sulfotransferase 1C1; sulfotransferase family, cytosolic, 1C, member 1; ST1C2; SULT1C1; humSULTC2; |
Gene ID | 6819 |
mRNA Refseq | NM_001056 |
Protein Refseq | NP_001047 |
MIM | 602385 |
UniProt ID | O00338 |
◆ Recombinant Proteins | ||
SULT1C2-16221M | Recombinant Mouse SULT1C2 Protein | +Inquiry |
SULT1C2-1823H | Recombinant Human SULT1C2 protein, GST-tagged | +Inquiry |
SULT1C2-30914TH | Recombinant Human SULT1C2, His-tagged | +Inquiry |
SULT1C2-892H | Active Recombinant Human SULT1C2 Protein, His-tagged | +Inquiry |
SULT1C2-94H | Active Recombinant Human SULT1C2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SULT1C2-1351HCL | Recombinant Human SULT1C2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SULT1C2 Products
Required fields are marked with *
My Review for All SULT1C2 Products
Required fields are marked with *