Recombinant Human SULT1C2 protein, GST-tagged

Cat.No. : SULT1C2-1823H
Product Overview : Recombinant Human SULT1C2 protein(1-296 aa), fused to GST tag, was expressed in E. coli.
Availability May 31, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-296 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SULT1C2 sulfotransferase family, cytosolic, 1C, member 2 [ Homo sapiens ]
Official Symbol SULT1C2
Synonyms SULT1C2; sulfotransferase family, cytosolic, 1C, member 2; sulfotransferase family, cytosolic, 1C, member 1 , SULT1C1; sulfotransferase 1C2; ST1C1; SULT1C#1; sulfotransferase 1C1; sulfotransferase family, cytosolic, 1C, member 1; ST1C2; SULT1C1; humSULTC2;
Gene ID 6819
mRNA Refseq NM_001056
Protein Refseq NP_001047
MIM 602385
UniProt ID O00338

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SULT1C2 Products

Required fields are marked with *

My Review for All SULT1C2 Products

Required fields are marked with *

0
cart-icon
0
compare icon