Recombinant Human SULT4A1 protein, GST-tagged
Cat.No. : | SULT4A1-301455H |
Product Overview : | Recombinant Human SULT4A1 (1-284 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Leu284 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCSAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | SULT4A1 sulfotransferase family 4A, member 1 [ Homo sapiens ] |
Official Symbol | SULT4A1 |
Synonyms | SULT4A1; sulfotransferase family 4A, member 1; sulfotransferase 4A1; hBR STL 1; SULTX3; ST4A1; hBR-STL; nervous system sulfotransferase; sulfotransferase-related protein; brain sulfotransferase-like protein; nervous system cytosolic sulfotransferase; NST; BRSTL1; BR-STL-1; DJ388M5.3; hBR-STL-1; MGC40032; |
Gene ID | 25830 |
mRNA Refseq | NM_014351 |
Protein Refseq | NP_055166 |
MIM | 608359 |
UniProt ID | Q9BR01 |
◆ Recombinant Proteins | ||
SULT4A1-199H | Recombinant Human SULT4A1 | +Inquiry |
SULT4A1-16233M | Recombinant Mouse SULT4A1 Protein | +Inquiry |
SULT4A1-3052H | Recombinant Human SULT4A1 protein, His-tagged | +Inquiry |
SULT4A1-3731Z | Recombinant Zebrafish SULT4A1 | +Inquiry |
SULT4A1-8867M | Recombinant Mouse SULT4A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SULT4A1-1347HCL | Recombinant Human SULT4A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SULT4A1 Products
Required fields are marked with *
My Review for All SULT4A1 Products
Required fields are marked with *
0
Inquiry Basket