Recombinant Human SUMO2 protein, His-tagged

Cat.No. : SUMO2-6323H
Product Overview : Recombinant Human SUMO2 protein(1-95 aa) was expressed in E. coli with a GST tag at the N-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-95 a.a.
Tag : GST
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage.
After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
Gene Name SUMO2 SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) [ Homo sapiens ]
Official Symbol SUMO2
Synonyms SUMO2; SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae); SMT3 (suppressor of mif two 3, yeast) homolog 2 , SMT3 suppressor of mif two 3 homolog 2 (yeast) , SMT3H2; small ubiquitin-related modifier 2; SMT3B; sentrin 2; SMT3 homolog 2; ubiquitin-like protein SMT3A; ubiquitin-like protein SMT3B; small ubiquitin-like modifier 2; HSMT3; SUMO3; Smt3A; SMT3H2; MGC117191;
Gene ID 6613
mRNA Refseq NM_001005849
Protein Refseq NP_001005849
MIM 603042
UniProt ID P61956

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SUMO2 Products

Required fields are marked with *

My Review for All SUMO2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon