Recombinant Human SUMO2 protein, His-tagged

• Cat.No.: SUMO2-6323H
• Product Overview: Recombinant Human SUMO2 protein(1-95 aa) was expressed in E. coli with a GST tag at the N-terminus.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-95 a.a.
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage.
  After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY

Gene Information

• Gene Name: SUMO2 SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: SUMO2
• Synonyms: SUMO2; SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae); SMT3 (suppressor of mif two 3, yeast) homolog 2 , SMT3 suppressor of mif two 3 homolog 2 (yeast) , SMT3H2; small ubiquitin-related modifier 2; SMT3B; sentrin 2; SMT3 homolog 2; ubiquitin-like protein SMT3A; ubiquitin-like protein SMT3B; small ubiquitin-like modifier 2; HSMT3; SUMO3; Smt3A; SMT3H2; MGC117191
• Gene ID: 6613
• mRNA Refseq: NM_001005849
• Protein Refseq: NP_001005849
• MIM: 603042
• UniProt ID: P61956