Recombinant Human SUPT5H protein, GST-tagged
| Cat.No. : | SUPT5H-3057H |
| Product Overview : | Recombinant Human SUPT5H protein(807-1087 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | September 22, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 807-1087 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | PLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSPMTPGAPSPGGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLLEA |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SUPT5H suppressor of Ty 5 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | SUPT5H |
| Synonyms | SUPT5H; suppressor of Ty 5 homolog (S. cerevisiae); suppressor of Ty (S.cerevisiae) 5 homolog; transcription elongation factor SPT5; FLJ34157; SPT5; SPT5H; hSPT5; DSIF p160; DSIF large subunit; Tat-cotransactivator 1 protein; DRB sensitivity-inducing factor large subunit; DRB sensitivity-inducing factor 160 kDa subunit; Tat-CT1; |
| Gene ID | 6829 |
| mRNA Refseq | NM_001111020 |
| Protein Refseq | NP_001104490 |
| MIM | 602102 |
| UniProt ID | O00267 |
| ◆ Recombinant Proteins | ||
| SUPT5H-3057H | Recombinant Human SUPT5H protein, GST-tagged | +Inquiry |
| SUPT5H-959H | Recombinant Human SUPT5H Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SUPT5H-3013H | Recombinant Human SUPT5H Protein, MYC/DDK-tagged | +Inquiry |
| SUPT5H-4381R | Recombinant Rhesus Macaque SUPT5H Protein, His (Fc)-Avi-tagged | +Inquiry |
| SUPT5H-8878M | Recombinant Mouse SUPT5H Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SUPT5H Products
Required fields are marked with *
My Review for All SUPT5H Products
Required fields are marked with *
