Recombinant Human SUPT5H protein, His-tagged

• Cat.No.: SUPT5H-3011H
• Product Overview: Recombinant Human SUPT5H protein(807-1087 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 807-1087 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: PLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSPMTPGAPSPGGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLLEA
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: SUPT5H suppressor of Ty 5 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: SUPT5H
• Synonyms: SUPT5H; suppressor of Ty 5 homolog (S. cerevisiae); suppressor of Ty (S.cerevisiae) 5 homolog; transcription elongation factor SPT5; FLJ34157; SPT5; SPT5H; hSPT5; DSIF p160; DSIF large subunit; Tat-cotransactivator 1 protein; DRB sensitivity-inducing factor large subunit; DRB sensitivity-inducing factor 160 kDa subunit; Tat-CT1
• Gene ID: 6829
• mRNA Refseq: NM_001111020
• Protein Refseq: NP_001104490
• MIM: 602102
• UniProt ID: O00267