Recombinant Human SUPT5H protein, His-tagged
Cat.No. : | SUPT5H-3011H |
Product Overview : | Recombinant Human SUPT5H protein(807-1087 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 807-1087 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | PLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSPMTPGAPSPGGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLLEA |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SUPT5H suppressor of Ty 5 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | SUPT5H |
Synonyms | SUPT5H; suppressor of Ty 5 homolog (S. cerevisiae); suppressor of Ty (S.cerevisiae) 5 homolog; transcription elongation factor SPT5; FLJ34157; SPT5; SPT5H; hSPT5; DSIF p160; DSIF large subunit; Tat-cotransactivator 1 protein; DRB sensitivity-inducing factor large subunit; DRB sensitivity-inducing factor 160 kDa subunit; Tat-CT1; |
Gene ID | 6829 |
mRNA Refseq | NM_001111020 |
Protein Refseq | NP_001104490 |
MIM | 602102 |
UniProt ID | O00267 |
◆ Recombinant Proteins | ||
SUPT5H-3057H | Recombinant Human SUPT5H protein, GST-tagged | +Inquiry |
SUPT5H-9201Z | Recombinant Zebrafish SUPT5H | +Inquiry |
SUPT5H-3200H | Recombinant Human SUPT5H Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SUPT5H-3013H | Recombinant Human SUPT5H Protein, MYC/DDK-tagged | +Inquiry |
SUPT5H-3035C | Recombinant Chicken SUPT5H | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SUPT5H Products
Required fields are marked with *
My Review for All SUPT5H Products
Required fields are marked with *
0
Inquiry Basket