Recombinant Human SUSD4 protein, His-tagged
Cat.No. : | SUSD4-3714H |
Product Overview : | Recombinant Human SUSD4 protein(42-290 aa), fused to His tag, was expressed in E. coli. |
Availability | August 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 42-290 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | FGPAQLTGGFDDLQVCADPGIPENGFRTPSGGVFFEGSVARFHCQDGFKLKGATKRLCLKHFNGTLGWIPSDNSICVQEDCRIPQIEDAEIHNKTYRHGEKLIITCHEGFKIRYPDLHNMVSLCRDDGTWNNLPICQGCLRPLASSNGYVNISELQTSFPVGTVISYRCFPGFKLDGSAYLECLQNLIWSSSPPRCLALEGGRPEHLFPVLYFPHIRLAAAVLYFCPVLKSSPTPAPTCSSTSTTTSLF |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SUSD4 sushi domain containing 4 [ Homo sapiens ] |
Official Symbol | SUSD4 |
Synonyms | SUSD4; sushi domain containing 4; sushi domain-containing protein 4; FLJ10052; YHGM196; PRO222; RP11-239E10.4; |
Gene ID | 55061 |
mRNA Refseq | NM_001037175 |
Protein Refseq | NP_001032252 |
UniProt ID | Q5VX71 |
◆ Recombinant Proteins | ||
SUSD4-3077H | Recombinant Human SUSD4 Protein, MYC/DDK-tagged | +Inquiry |
SUSD4-16259M | Recombinant Mouse SUSD4 Protein | +Inquiry |
Susd4-6232M | Recombinant Mouse Susd4 Protein, Myc/DDK-tagged | +Inquiry |
SUSD4-138H | Recombinant Human SUSD4, Fc tagged | +Inquiry |
SUSD4-2609M | Recombinant Mouse SUSD4 Protein (42-319 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUSD4-787HCL | Recombinant Human SUSD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SUSD4 Products
Required fields are marked with *
My Review for All SUSD4 Products
Required fields are marked with *