Recombinant Human SUSD4 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SUSD4-6002H |
| Product Overview : | SUSD4 MS Standard C13 and N15-labeled recombinant protein (NP_001032252) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | SUSD4 (Sushi Domain Containing 4) is a Protein Coding gene. Diseases associated with SUSD4 include Chromosome 1Q41-Q42 Deletion Syndrome. An important paralog of this gene is CSMD2. |
| Molecular Mass : | 32.2 kDa |
| AA Sequence : | MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGGFDDLQVCADPGIPENGFRTPSGGVFFEGSVARFHCQDGFKLKGATKRLCLKHFNGTLGWIPSDNSICVQEDCRIPQIEDAEIHNKTYRHGEKLIITCHEGFKIRYPDLHNMVSLCRDDGTWNNLPICQGCLRPLASSNGYVNISELQTSFPVGTVISYRCFPGFKLDGSAYLECLQNLIWSSSPPRCLALEGGRPEHLFPVLYFPHIRLAAAVLYFCPVLKSSPTPAPTCSSTSTTTSLFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SUSD4 sushi domain containing 4 [ Homo sapiens (human) ] |
| Official Symbol | SUSD4 |
| Synonyms | SUSD4; sushi domain containing 4; sushi domain-containing protein 4; FLJ10052; YHGM196; PRO222; RP11-239E10.4; |
| Gene ID | 55061 |
| mRNA Refseq | NM_001037175 |
| Protein Refseq | NP_001032252 |
| MIM | 615827 |
| UniProt ID | Q5VX71 |
| ◆ Recombinant Proteins | ||
| SUSD4-16259M | Recombinant Mouse SUSD4 Protein | +Inquiry |
| SUSD4-3077H | Recombinant Human SUSD4 Protein, MYC/DDK-tagged | +Inquiry |
| SUSD4-2609M | Recombinant Mouse SUSD4 Protein (42-319 aa), His-tagged | +Inquiry |
| Susd4-6232M | Recombinant Mouse Susd4 Protein, Myc/DDK-tagged | +Inquiry |
| SUSD4-2356H | Recombinant Human SUSD4 protein(Met1-Phe290), mFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SUSD4-787HCL | Recombinant Human SUSD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SUSD4 Products
Required fields are marked with *
My Review for All SUSD4 Products
Required fields are marked with *
