Recombinant Human SUSD4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SUSD4-6002H
Product Overview : SUSD4 MS Standard C13 and N15-labeled recombinant protein (NP_001032252) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : SUSD4 (Sushi Domain Containing 4) is a Protein Coding gene. Diseases associated with SUSD4 include Chromosome 1Q41-Q42 Deletion Syndrome. An important paralog of this gene is CSMD2.
Molecular Mass : 32.2 kDa
AA Sequence : MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGGFDDLQVCADPGIPENGFRTPSGGVFFEGSVARFHCQDGFKLKGATKRLCLKHFNGTLGWIPSDNSICVQEDCRIPQIEDAEIHNKTYRHGEKLIITCHEGFKIRYPDLHNMVSLCRDDGTWNNLPICQGCLRPLASSNGYVNISELQTSFPVGTVISYRCFPGFKLDGSAYLECLQNLIWSSSPPRCLALEGGRPEHLFPVLYFPHIRLAAAVLYFCPVLKSSPTPAPTCSSTSTTTSLFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SUSD4 sushi domain containing 4 [ Homo sapiens (human) ]
Official Symbol SUSD4
Synonyms SUSD4; sushi domain containing 4; sushi domain-containing protein 4; FLJ10052; YHGM196; PRO222; RP11-239E10.4;
Gene ID 55061
mRNA Refseq NM_001037175
Protein Refseq NP_001032252
MIM 615827
UniProt ID Q5VX71

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SUSD4 Products

Required fields are marked with *

My Review for All SUSD4 Products

Required fields are marked with *

0
cart-icon