Recombinant Mouse Sycp3 protein, Avi-tagged, Biotinylated
Cat.No. : | Sycp3-4856M |
Product Overview : | Biotinylated Recombinant Mouse Sycp3 protein(P70281)(1-254 aa), fused with Avi tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Avi |
Protein Length : | 1-254 aa |
Conjugation/Label : | Biotin |
Form : | Tris/PBS-based buffer, 6% Trehalose. |
AASequence : | MLRGCGDSDSSPEPLSKHLKMVPGGRKHSGKSGKPPLVDQPKKAFDFEKDDKDLSGSEED VADEKAPVIDKHGKKRSAGIIEDVGGEVQNMLEKFGADINKALLAKRKRIEMYTKASFKA SNQKIEQIWKTQQEEIQKLNNEYSQQFMNVLQQWELDIQKFEEQGEKLSNLFRQQQKIFQ QSRIVQSQRMFAMKQIHEQFIKSLEDVEKNNDNLFTGTQSELKKEMAMLQKKVMMETQQQ EMANVRKSLQSMLF |
Purity : | >85% (SDS-PAGE) |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | Sycp3 synaptonemal complex protein 3 [ Mus musculus ] |
Official Symbol | Sycp3 |
Synonyms | SYCP3; synaptonemal complex protein 3; SCP-3; Cor1; Scp3; |
Gene ID | 20962 |
mRNA Refseq | NM_011517 |
Protein Refseq | NP_035647 |
◆ Recombinant Proteins | ||
SYCP3-5857R | Recombinant Rat SYCP3 Protein | +Inquiry |
SYCP3-30175H | Recombinant Human SYCP3 protein, GST-tagged | +Inquiry |
SYCP3-12HFL | Recombinant Full Length Human synaptonemal complex protein 3 Protein, His-tagged | +Inquiry |
SYCP3-30174H | Recombinant Human SYCP3 protein, GST-tagged | +Inquiry |
SYCP3-5516R | Recombinant Rat SYCP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYCP3-1322HCL | Recombinant Human SYCP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Sycp3 Products
Required fields are marked with *
My Review for All Sycp3 Products
Required fields are marked with *
0
Inquiry Basket