Recombinant Human SYF2, His-tagged

• Cat.No.: SYF2-27466TH
• Product Overview: Recombinant fragment of Human GCIP interacting protein p29 with an N terminal His tag 20.5 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 150 amino acids
• Description: This gene encodes a nuclear protein that interacts with cyclin D-type binding-protein 1, which is thought to be a cell cycle regulator at the G1/S transition. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Conjugation: HIS
• Molecular Weight: 20.500kDa inclusive of tags
• Tissue specificity: Abundantly expressed in the heart, skeletal muscle and kidney. Expressed at lower level other tissues.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride, 0.08% DTT, 0.06% EDTA
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDYINERNAKFNKKAERFYGKYTAEIKQNLERGTAV
• Sequence Similarities: Belongs to the SYF2 family.

Gene Information

• Gene Name: SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: SYF2
• Synonyms: SYF2; SYF2 homolog, RNA splicing factor (S. cerevisiae); CBPIN, CCNDBP1 interactor; pre-mRNA-splicing factor SYF2; DKFZp564O2082; fSAP29; functional spliceosome associated protein 29; NTC31; p29
• Gene ID: 25949
• mRNA Refseq: NM_015484
• Protein Refseq: NP_056299
• MIM: 607090
• Uniprot ID: O95926
• Chromosome Location: 1p36.11
• Pathway: Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem