Recombinant Human SYF2, His-tagged
Cat.No. : | SYF2-27466TH |
Product Overview : | Recombinant fragment of Human GCIP interacting protein p29 with an N terminal His tag 20.5 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 150 amino acids |
Description : | This gene encodes a nuclear protein that interacts with cyclin D-type binding-protein 1, which is thought to be a cell cycle regulator at the G1/S transition. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
Conjugation : | HIS |
Molecular Weight : | 20.500kDa inclusive of tags |
Tissue specificity : | Abundantly expressed in the heart, skeletal muscle and kidney. Expressed at lower level other tissues. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride, 0.08% DTT, 0.06% EDTA |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDYINERNAKFNKKAERFYGKYTAEIKQNLERGTAV |
Sequence Similarities : | Belongs to the SYF2 family. |
Gene Name | SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | SYF2 |
Synonyms | SYF2; SYF2 homolog, RNA splicing factor (S. cerevisiae); CBPIN, CCNDBP1 interactor; pre-mRNA-splicing factor SYF2; DKFZp564O2082; fSAP29; functional spliceosome associated protein 29; NTC31; p29; |
Gene ID | 25949 |
mRNA Refseq | NM_015484 |
Protein Refseq | NP_056299 |
MIM | 607090 |
Uniprot ID | O95926 |
Chromosome Location | 1p36.11 |
Pathway | Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem; |
◆ Recombinant Proteins | ||
SYF2-887Z | Recombinant Zebrafish SYF2 | +Inquiry |
SYF2-5101H | Recombinant Human SYF2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SYF2-5517R | Recombinant Rat SYF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SYF2-4732H | Recombinant Human SYF2, His-tagged | +Inquiry |
SYF2-4615C | Recombinant Chicken SYF2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYF2-1321HCL | Recombinant Human SYF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SYF2 Products
Required fields are marked with *
My Review for All SYF2 Products
Required fields are marked with *
0
Inquiry Basket