Recombinant Human SYF2, His-tagged

Cat.No. : SYF2-27466TH
Product Overview : Recombinant fragment of Human GCIP interacting protein p29 with an N terminal His tag 20.5 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 150 amino acids
Description : This gene encodes a nuclear protein that interacts with cyclin D-type binding-protein 1, which is thought to be a cell cycle regulator at the G1/S transition. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Conjugation : HIS
Molecular Weight : 20.500kDa inclusive of tags
Tissue specificity : Abundantly expressed in the heart, skeletal muscle and kidney. Expressed at lower level other tissues.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride, 0.08% DTT, 0.06% EDTA
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDYINERNAKFNKKAERFYGKYTAEIKQNLERGTAV
Sequence Similarities : Belongs to the SYF2 family.
Gene Name SYF2 SYF2 homolog, RNA splicing factor (S. cerevisiae) [ Homo sapiens ]
Official Symbol SYF2
Synonyms SYF2; SYF2 homolog, RNA splicing factor (S. cerevisiae); CBPIN, CCNDBP1 interactor; pre-mRNA-splicing factor SYF2; DKFZp564O2082; fSAP29; functional spliceosome associated protein 29; NTC31; p29;
Gene ID 25949
mRNA Refseq NM_015484
Protein Refseq NP_056299
MIM 607090
Uniprot ID O95926
Chromosome Location 1p36.11
Pathway Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SYF2 Products

Required fields are marked with *

My Review for All SYF2 Products

Required fields are marked with *

0
cart-icon