Recombinant Human SYNGAP1 Protein (1161-1343 aa), His-tagged

• Cat.No.: SYNGAP1-2648H
• Product Overview: Recombinant Human SYNGAP1 Protein (1161-1343 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1161-1343 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 25.5 kDa
• AA Sequence: MPHLSADIESAHIEREEYKLKEYSKSMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDHPAMAEPLPEPKKRLLDAQERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: SYNGAP1 synaptic Ras GTPase activating protein 1 [ Homo sapiens ]
• Official Symbol: SYNGAP1
• Synonyms: SYNGAP1; KIAA1938; RASA5; SYNGAP; neuronal RasGAP; synaptic Ras GTPase-activating protein 1; MRD5; RASA1; DKFZp761G1421
• Gene ID: 8831
• mRNA Refseq: NM_006772
• Protein Refseq: NP_006763
• MIM: 603384
• UniProt ID: Q96PV0