Recombinant Human SYNGR1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SYNGR1-3300H |
Product Overview : | SYNGR1 MS Standard C13 and N15-labeled recombinant protein (NP_663783) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes an integral membrane protein associated with presynaptic vesicles in neuronal cells. The exact function of this protein is unclear, but studies of a similar murine protein suggest that it functions in synaptic plasticity without being required for synaptic transmission. The gene product belongs to the synaptogyrin gene family. Three alternatively spliced variants encoding three different isoforms have been identified. |
Molecular Mass : | 21 kDa |
AA Sequence : | MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPLNEGTDAARAAIAFSFFSIFTWSLTAALAVRRFKDLSFQEEYSTLFPASAQPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SYNGR1 synaptogyrin 1 [ Homo sapiens (human) ] |
Official Symbol | SYNGR1 |
Synonyms | SYNGR1; synaptogyrin 1; synaptogyrin-1 |
Gene ID | 9145 |
mRNA Refseq | NM_145731 |
Protein Refseq | NP_663783 |
MIM | 603925 |
UniProt ID | O43759 |
◆ Recombinant Proteins | ||
SYNGR1-2126H | Recombinant Human SYNGR1 Protein (1-191 aa), GST-tagged | +Inquiry |
SYNGR1-5525R | Recombinant Rat SYNGR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SYNGR1-3300H | Recombinant Human SYNGR1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SYNGR1-4564C | Recombinant Chicken SYNGR1 | +Inquiry |
SYNGR1-8533H | Recombinant Human SYNGR1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYNGR1-1318HCL | Recombinant Human SYNGR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYNGR1 Products
Required fields are marked with *
My Review for All SYNGR1 Products
Required fields are marked with *