Recombinant Human SYNGR1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SYNGR1-3300H
Product Overview : SYNGR1 MS Standard C13 and N15-labeled recombinant protein (NP_663783) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes an integral membrane protein associated with presynaptic vesicles in neuronal cells. The exact function of this protein is unclear, but studies of a similar murine protein suggest that it functions in synaptic plasticity without being required for synaptic transmission. The gene product belongs to the synaptogyrin gene family. Three alternatively spliced variants encoding three different isoforms have been identified.
Molecular Mass : 21 kDa
AA Sequence : MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPLNEGTDAARAAIAFSFFSIFTWSLTAALAVRRFKDLSFQEEYSTLFPASAQPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SYNGR1 synaptogyrin 1 [ Homo sapiens (human) ]
Official Symbol SYNGR1
Synonyms SYNGR1; synaptogyrin 1; synaptogyrin-1
Gene ID 9145
mRNA Refseq NM_145731
Protein Refseq NP_663783
MIM 603925
UniProt ID O43759

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SYNGR1 Products

Required fields are marked with *

My Review for All SYNGR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon