Recombinant Human TACSTD2
Cat.No. : | TACSTD2-30839TH |
Product Overview : | Recombinant full length Human TACD2 with N terminal proprietary tag, 58.78kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 298 amino acids |
Description : | This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy. |
Molecular Weight : | 58.780kDa inclusive of tags |
Tissue specificity : | Placenta, pancreatic carcinoma cell lines. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDC STLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDP DCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCD ELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRL HPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYF ERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPP KFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKY KKVEIKELGELRKEPSL |
Sequence Similarities : | Belongs to the EPCAM family.Contains 1 thyroglobulin type-1 domain. |
Gene Name | TACSTD2 tumor-associated calcium signal transducer 2 [ Homo sapiens ] |
Official Symbol | TACSTD2 |
Synonyms | TACSTD2; tumor-associated calcium signal transducer 2; M1S1; EGP 1; GA733 1; TROP2; |
Gene ID | 4070 |
mRNA Refseq | NM_002353 |
Protein Refseq | NP_002344 |
MIM | 137290 |
Uniprot ID | P09758 |
Chromosome Location | 1p32 |
Function | receptor activity; |
◆ Recombinant Proteins | ||
TACSTD2-0768M | Recombinant Mouse TACSTD2 protein, His-tagged | +Inquiry |
TACSTD2-0767H | Active Recombinant Human TACSTD2 protein, His-Avi-tagged, Biotinylated | +Inquiry |
TACSTD2-2153H | Recombinant Human TACSTD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TACSTD2-1027R | Recombinant Rhesus TACSTD2 Protein (Met1-Arg272), His-tagged | +Inquiry |
TACSTD2-0771H | Active Recombinant Human TACSTD2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TACSTD2-78H | Active Recombinant Human TACSTD2 Protein, Flag&His tagged | +Inquiry |
Tacstd2-64M | Active Recombinant Mouse Tacstd2 Homodimer Protein, Flag&His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TACSTD2-2546HCL | Recombinant Human TACSTD2 cell lysate | +Inquiry |
TACSTD2-1630MCL | Recombinant Mouse TACSTD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TACSTD2 Products
Required fields are marked with *
My Review for All TACSTD2 Products
Required fields are marked with *