Recombinant Human TACSTD2
| Cat.No. : | TACSTD2-30839TH |
| Product Overview : | Recombinant full length Human TACD2 with N terminal proprietary tag, 58.78kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 298 amino acids |
| Description : | This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy. |
| Molecular Weight : | 58.780kDa inclusive of tags |
| Tissue specificity : | Placenta, pancreatic carcinoma cell lines. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDC STLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDP DCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCD ELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRL HPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYF ERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPP KFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKY KKVEIKELGELRKEPSL |
| Sequence Similarities : | Belongs to the EPCAM family.Contains 1 thyroglobulin type-1 domain. |
| Gene Name | TACSTD2 tumor-associated calcium signal transducer 2 [ Homo sapiens ] |
| Official Symbol | TACSTD2 |
| Synonyms | TACSTD2; tumor-associated calcium signal transducer 2; M1S1; EGP 1; GA733 1; TROP2; |
| Gene ID | 4070 |
| mRNA Refseq | NM_002353 |
| Protein Refseq | NP_002344 |
| MIM | 137290 |
| Uniprot ID | P09758 |
| Chromosome Location | 1p32 |
| Function | receptor activity; |
| ◆ Recombinant Proteins | ||
| TACSTD2-0768M | Recombinant Mouse TACSTD2 protein, His-tagged | +Inquiry |
| TACSTD2-1027R | Recombinant Rhesus TACSTD2 Protein (Met1-Arg272), His-tagged | +Inquiry |
| Tacstd2-6273M | Recombinant Mouse Tacstd2 Protein, Myc/DDK-tagged | +Inquiry |
| TACSTD2-30839TH | Recombinant Human TACSTD2 | +Inquiry |
| TACSTD2-10H | Recombinant Human TACSTD2 protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| Tacstd2-64M | Active Recombinant Mouse Tacstd2 Homodimer Protein, Flag&His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TACSTD2-1630MCL | Recombinant Mouse TACSTD2 cell lysate | +Inquiry |
| TACSTD2-2546HCL | Recombinant Human TACSTD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TACSTD2 Products
Required fields are marked with *
My Review for All TACSTD2 Products
Required fields are marked with *
