Recombinant Human TADA2B Protein, GST-tagged
| Cat.No. : | TADA2B-4343H |
| Product Overview : | Human MGC21874 partial ORF ( XP_291105, 2 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | TADA2B functions as a transcriptional adaptor protein that potentiates transcription through coordination of histone acetyltransferase (HAT) activity and by linking activation factors to basal transcriptional machinery (Barlev et al., 2003 [PubMed 12972612]).[supplied by OMIM, Apr 2010] |
| Molecular Mass : | 37.73 kDa |
| AA Sequence : | AELGKKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQLVDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHY |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | TADA2B transcriptional adaptor 2B [ Homo sapiens ] |
| Official Symbol | TADA2B |
| Synonyms | TADA2B; transcriptional adaptor 2B; transcriptional adapter 2-beta; MGC21874; ADA2-beta; ADA2-like protein beta; transcriptional adaptor 2 (ADA2 homolog, yeast)-beta; ADA2B; ADA2(beta); |
| Gene ID | 93624 |
| mRNA Refseq | NM_152293 |
| Protein Refseq | NP_689506 |
| MIM | 608790 |
| UniProt ID | Q86TJ2 |
| ◆ Recombinant Proteins | ||
| TADA2B-3097H | Recombinant Human TADA2B, His-tagged | +Inquiry |
| TADA2B-4343H | Recombinant Human TADA2B Protein, GST-tagged | +Inquiry |
| TADA2B-3041Z | Recombinant Zebrafish TADA2B | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TADA2B Products
Required fields are marked with *
My Review for All TADA2B Products
Required fields are marked with *
