Recombinant Human TADA2B Protein, GST-tagged

Cat.No. : TADA2B-4343H
Product Overview : Human MGC21874 partial ORF ( XP_291105, 2 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : TADA2B functions as a transcriptional adaptor protein that potentiates transcription through coordination of histone acetyltransferase (HAT) activity and by linking activation factors to basal transcriptional machinery (Barlev et al., 2003 [PubMed 12972612]).[supplied by OMIM, Apr 2010]
Molecular Mass : 37.73 kDa
AA Sequence : AELGKKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQLVDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TADA2B transcriptional adaptor 2B [ Homo sapiens ]
Official Symbol TADA2B
Synonyms TADA2B; transcriptional adaptor 2B; transcriptional adapter 2-beta; MGC21874; ADA2-beta; ADA2-like protein beta; transcriptional adaptor 2 (ADA2 homolog, yeast)-beta; ADA2B; ADA2(beta);
Gene ID 93624
mRNA Refseq NM_152293
Protein Refseq NP_689506
MIM 608790
UniProt ID Q86TJ2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TADA2B Products

Required fields are marked with *

My Review for All TADA2B Products

Required fields are marked with *

0
cart-icon
0
compare icon