Recombinant Human TAF12 protein, His-SUMO-tagged
| Cat.No. : | TAF12-4448H |
| Product Overview : | Recombinant Human TAF12 protein(Q16514)(1-161aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-161aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 33.9 kDa |
| AA Sequence : | MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa [ Homo sapiens ] |
| Official Symbol | TAF12 |
| Synonyms | TAF12; TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa; TAF2J, TATA box binding protein (TBP) associated factor, RNA polymerase II, J, 20kD; transcription initiation factor TFIID subunit 12; TAFII20; TAFII20/TAFII15; TAFII-20/TAFII-15; transcription initiation factor TFIID 20/15 kDa subunits; TATA box binding protein (TBP)-associated factor, RNA polymerase II, J, 20kD; TAF2J; |
| Gene ID | 6883 |
| mRNA Refseq | NM_001135218 |
| Protein Refseq | NP_001128690 |
| MIM | 600773 |
| UniProt ID | Q16514 |
| ◆ Recombinant Proteins | ||
| TAF12-4448H | Recombinant Human TAF12 protein, His-SUMO-tagged | +Inquiry |
| TAF12-6392H | Recombinant Human TAF12 Protein (Met1-Lys161), N-His tagged | +Inquiry |
| TAF12-9827Z | Recombinant Zebrafish TAF12 | +Inquiry |
| TAF12-3101H | Recombinant Human TAF12, GST-tagged | +Inquiry |
| TAF12-2583C | Recombinant Chicken TAF12 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TAF12-1276HCL | Recombinant Human TAF12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAF12 Products
Required fields are marked with *
My Review for All TAF12 Products
Required fields are marked with *
