Recombinant Human TAF12 protein, His-SUMO-tagged
Cat.No. : | TAF12-4448H |
Product Overview : | Recombinant Human TAF12 protein(Q16514)(1-161aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-161aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.9 kDa |
AA Sequence : | MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa [ Homo sapiens ] |
Official Symbol | TAF12 |
Synonyms | TAF12; TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa; TAF2J, TATA box binding protein (TBP) associated factor, RNA polymerase II, J, 20kD; transcription initiation factor TFIID subunit 12; TAFII20; TAFII20/TAFII15; TAFII-20/TAFII-15; transcription initiation factor TFIID 20/15 kDa subunits; TATA box binding protein (TBP)-associated factor, RNA polymerase II, J, 20kD; TAF2J; |
Gene ID | 6883 |
mRNA Refseq | NM_001135218 |
Protein Refseq | NP_001128690 |
MIM | 600773 |
UniProt ID | Q16514 |
◆ Recombinant Proteins | ||
TAF12-4448H | Recombinant Human TAF12 protein, His-SUMO-tagged | +Inquiry |
TAF12-101H | Recombinant Human TAF12 Protein, His-tagged | +Inquiry |
TAF12-2583C | Recombinant Chicken TAF12 | +Inquiry |
TAF12-3101H | Recombinant Human TAF12, GST-tagged | +Inquiry |
TAF12-265H | Recombinant Human TAF12 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAF12-1276HCL | Recombinant Human TAF12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAF12 Products
Required fields are marked with *
My Review for All TAF12 Products
Required fields are marked with *