Recombinant Human TAF5 protein, His-tagged

Cat.No. : TAF5-2987H
Product Overview : Recombinant Human TAF5 protein(655-800 aa), fused with N-terminal His tag, was expressed in E.coli.
Availability July 09, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 655-800 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
AASequence : DVLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGAYSPQ
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name TAF5 TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa [ Homo sapiens ]
Official Symbol TAF5
Synonyms TAF5; TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa; TAF2D, TATA box binding protein (TBP) associated factor, RNA polymerase II, D, 100kD; transcription initiation factor TFIID subunit 5; TAFII100; TAFII-100; TAF(II)100; TATA box binding protein (TBP)-associated factor 2D; transcription initiation factor TFIID 100 kD subunit; transcription initiation factor TFIID 100 kDa subunit; TATA box binding protein (TBP)-associated factor, RNA polymerase II, D, 100kD; TAF2D;
Gene ID 6877
mRNA Refseq NM_006951
Protein Refseq NP_008882
MIM 601787
UniProt ID Q15542

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TAF5 Products

Required fields are marked with *

My Review for All TAF5 Products

Required fields are marked with *

0
cart-icon
0
compare icon