Recombinant Human TAF5 protein, His-tagged

Cat.No. : TAF5-2987H
Product Overview : Recombinant Human TAF5 protein(655-800 aa), fused to His tag, was expressed in E. coli.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 655-800 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : DVLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGAYSPQ
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name TAF5 TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa [ Homo sapiens ]
Official Symbol TAF5
Synonyms TAF5; TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa; TAF2D, TATA box binding protein (TBP) associated factor, RNA polymerase II, D, 100kD; transcription initiation factor TFIID subunit 5; TAFII100; TAFII-100; TAF(II)100; TATA box binding protein (TBP)-associated factor 2D; transcription initiation factor TFIID 100 kD subunit; transcription initiation factor TFIID 100 kDa subunit; TATA box binding protein (TBP)-associated factor, RNA polymerase II, D, 100kD; TAF2D;
Gene ID 6877
mRNA Refseq NM_006951
Protein Refseq NP_008882
MIM 601787
UniProt ID Q15542

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TAF5 Products

Required fields are marked with *

My Review for All TAF5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon