Recombinant Human TAF5 protein, His-tagged
Cat.No. : | TAF5-2987H |
Product Overview : | Recombinant Human TAF5 protein(655-800 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 655-800 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | DVLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGAYSPQ |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | TAF5 TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa [ Homo sapiens ] |
Official Symbol | TAF5 |
Synonyms | TAF5; TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa; TAF2D, TATA box binding protein (TBP) associated factor, RNA polymerase II, D, 100kD; transcription initiation factor TFIID subunit 5; TAFII100; TAFII-100; TAF(II)100; TATA box binding protein (TBP)-associated factor 2D; transcription initiation factor TFIID 100 kD subunit; transcription initiation factor TFIID 100 kDa subunit; TATA box binding protein (TBP)-associated factor, RNA polymerase II, D, 100kD; TAF2D; |
Gene ID | 6877 |
mRNA Refseq | NM_006951 |
Protein Refseq | NP_008882 |
MIM | 601787 |
UniProt ID | Q15542 |
◆ Recombinant Proteins | ||
TAF5-2895C | Recombinant Chicken TAF5 | +Inquiry |
TAF5-2988H | Recombinant Human TAF5 protein, GST-tagged | +Inquiry |
TAF5-2987H | Recombinant Human TAF5 protein, His-tagged | +Inquiry |
TAF5-3543Z | Recombinant Zebrafish TAF5 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TAF5 Products
Required fields are marked with *
My Review for All TAF5 Products
Required fields are marked with *
0
Inquiry Basket