Recombinant Human TANK
Cat.No. : | TANK-31443TH |
Product Overview : | Recombinant fragment of Human TANK , predicted MWt 13.6kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 119 amino acids |
Description : | The TRAF (tumor necrosis factor receptor-associated factor) family of proteins associate with and transduce signals from members of the tumor necrosis factor receptor superfamily. The protein encoded by this gene is found in the cytoplasm and can bind to TRAF1, TRAF2, or TRAF3, thereby inhibiting TRAF function by sequestering the TRAFs in a latent state in the cytoplasm. For example, the protein encoded by this gene can block TRAF2 binding to LMP1, the Epstein-Barr virus transforming protein, and inhibit LMP1-mediated NF-kappa-B activation. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 13.600kDa |
Tissue specificity : | Ubiquitous. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituent:0.24% Tris |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQR IREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLE DSETRKNNLTLDQPQDKVISGIAREKLPKVDIASAESSI |
Sequence Similarities : | Contains 1 C2H2-type zinc finger. |
Gene Name | TANK TRAF family member-associated NFKB activator [ Homo sapiens ] |
Official Symbol | TANK |
Synonyms | TANK; TRAF family member-associated NFKB activator; TRAF2; TRAF family member-associated NF-kappa-B activator; I TRAF; |
Gene ID | 10010 |
mRNA Refseq | NM_004180 |
Protein Refseq | NP_004171 |
MIM | 603893 |
Uniprot ID | Q92844 |
Chromosome Location | 2q24-q31 |
Pathway | Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; RIG-I-like receptor signaling pathway, organism-specific biosystem; RIG-I-like receptor signaling pathway, conserved biosystem; RIG-I/MDA5 mediated induction of IFN-alpha/beta pathways, organism-specific biosystem; |
Function | metal ion binding; protein binding; |
◆ Recombinant Proteins | ||
TANK-517H | Recombinant Human TANK | +Inquiry |
TANK-3551H | Recombinant Human TANK protein, GST-tagged | +Inquiry |
TANK-4431R | Recombinant Rhesus Macaque TANK Protein, His (Fc)-Avi-tagged | +Inquiry |
TANK-7244H | Recombinant Human TANK, His-tagged | +Inquiry |
TANK-5509H | Recombinant Human TANK Protein (Leu131-Ile369), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TANK-1256HCL | Recombinant Human TANK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TANK Products
Required fields are marked with *
My Review for All TANK Products
Required fields are marked with *