Recombinant Human TARDBP, GST-tagged
| Cat.No. : | TARDBP-4735H |
| Product Overview : | Recombinant Human TARDBP(1 a.a. - 260 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20. |
| Molecular Mass : | 54.34 kDa |
| AA Sequence : | MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVV NYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFV RFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKP FRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA |
| Applications : | ELISA; WB-Re; AP; Array |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | TARDBP TAR DNA binding protein [ Homo sapiens (human) ] |
| Official Symbol | TARDBP |
| Synonyms | TARDBP; TDP-43; TAR DNA binding protein; ASL 10; TAR DNA-binding protein 43; TDP43; TAR DNA-binding protein 43; OTTHUMP00000002173; TRA DNA-binding protein-43 |
| Gene ID | 23435 |
| mRNA Refseq | NM_007375 |
| Protein Refseq | NP_003140 |
| MIM | 605078 |
| UniProt ID | Q13148 |
| Chromosome Location | 1p36.22 |
| Function | RNA binding; double-stranded DNA binding; mRNA 3'-UTR binding; nucleotide binding; protein binding; sequence-specific DNA binding transcription factor activity |
| ◆ Recombinant Proteins | ||
| TARDBP-22H | Recombinant Human TARDBP Protein, Tag Free | +Inquiry |
| TARDBP-35H | Recombinant Human TARDBP, MYC/DDK-tagged | +Inquiry |
| Tardbp-2006M | Recombinant Mouse Tardbp protein, His-tagged | +Inquiry |
| TARDBP-3552H | Recombinant Human TARDBP protein, His-SUMO-tagged | +Inquiry |
| TARDBP-30150TH | Recombinant Human TARDBP | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TARDBP-307HKCL | Human TARDBP Knockdown Cell Lysate | +Inquiry |
| TARDBP-1251HCL | Recombinant Human TARDBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TARDBP Products
Required fields are marked with *
My Review for All TARDBP Products
Required fields are marked with *
