Recombinant Human TARDBP, GST-tagged
Cat.No. : | TARDBP-4735H |
Product Overview : | Recombinant Human TARDBP(1 a.a. - 260 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20. |
Molecular Mass : | 54.34 kDa |
AA Sequence : | MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVV NYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFV RFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKP FRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TARDBP TAR DNA binding protein [ Homo sapiens (human) ] |
Official Symbol | TARDBP |
Synonyms | TARDBP; TDP-43; TAR DNA binding protein; ASL 10; TAR DNA-binding protein 43; TDP43; TAR DNA-binding protein 43; OTTHUMP00000002173; TRA DNA-binding protein-43 |
Gene ID | 23435 |
mRNA Refseq | NM_007375 |
Protein Refseq | NP_003140 |
MIM | 605078 |
UniProt ID | Q13148 |
Chromosome Location | 1p36.22 |
Function | RNA binding; double-stranded DNA binding; mRNA 3'-UTR binding; nucleotide binding; protein binding; sequence-specific DNA binding transcription factor activity |
◆ Recombinant Proteins | ||
Tardbp-6294M | Recombinant Mouse Tardbp Protein, Myc/DDK-tagged | +Inquiry |
TARDBP-2569C | Recombinant Chicken TARDBP | +Inquiry |
TARDBP-116H | Recombinant Human TARDBP Protein, GST-tagged | +Inquiry |
TARDBP-3345HFL | Recombinant Full Length Human TARDBP, Flag-tagged | +Inquiry |
TARDBP-40H | Recombinant Human TARDBP protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TARDBP-1251HCL | Recombinant Human TARDBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TARDBP Products
Required fields are marked with *
My Review for All TARDBP Products
Required fields are marked with *