Recombinant Human TARDBP protein, GST-tagged
Cat.No. : | TARDBP-39H |
Product Overview : | Recombinant Human TARDBP(1 - 260 aa) fused with GST tag was expressed in E. coli. |
Availability | October 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1 - 260 aa |
Description : | HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20. |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). Normally 5 % - 8 % trehalose and mannitol are added as protectants before lyophilization. |
AA Sequence : | MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Stability and Storage: Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder. Storage of Reconstituted Protein: Short-term storage: Store at 2-8 centigrade for two weeks. Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below). |
Gene Name | TARDBP TAR DNA binding protein [ Homo sapiens ] |
Official Symbol | TARDBP |
Synonyms | TARDBP; TAR DNA binding protein; TAR DNA-binding protein 43; ALS10; TDP 43; TAR DNA-binding protein-43; TDP-43; |
Gene ID | 23435 |
mRNA Refseq | NM_007375 |
Protein Refseq | NP_031401 |
MIM | 605078 |
UniProt ID | Q13148 |
Chromosome Location | 1p36.22 |
Function | DNA binding; RNA binding; double-stranded DNA binding; mRNA 3-UTR binding; nucleotide binding; protein binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
TARDBP-11522Z | Recombinant Zebrafish TARDBP | +Inquiry |
TARDBP-36H | Recombinant Human TARDBP, DDK-tagged | +Inquiry |
TARDBP-4735H | Recombinant Human TARDBP, GST-tagged | +Inquiry |
TARDBP-22H | Recombinant Human TARDBP Protein, Tag Free | +Inquiry |
TARDBP-2192H | Recombinant Human TARDBP Protein (1-396 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TARDBP-1251HCL | Recombinant Human TARDBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TARDBP Products
Required fields are marked with *
My Review for All TARDBP Products
Required fields are marked with *