"TARDBP" Related Products

Expand
Expand
Expand

Recombinant Human TARDBP protein, GST-tagged

Cat.No.: TARDBP-39H
Product Overview: Recombinant Human TARDBP(1 - 260 aa) fused with GST tag was expressed in E. coli.
Description: HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20.
Source: E. coli
Species: Human
Tag : GST
Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). Normally 5 % - 8 % trehalose and mannitol are added as protectants before lyophilization.
Protein length: 1 - 260 aa
AA Sequence: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA
Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage: Stability and Storage: Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.
Storage of Reconstituted Protein: Short-term storage: Store at 2-8 centigrade for two weeks.
Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below).
Gene Name: TARDBP TAR DNA binding protein [ Homo sapiens ]
Official Symbol: TARDBP
Synonyms: TARDBP; TAR DNA binding protein; TAR DNA-binding protein 43; ALS10; TDP 43; TAR DNA-binding protein-43; TDP-43;
Gene ID: 23435
mRNA Refseq: NM_007375
Protein Refseq: NP_031401
MIM: 605078
UniProt ID: Q13148
Chromosome Location: 1p36.22
Function: DNA binding; RNA binding; double-stranded DNA binding; mRNA 3-UTR binding; nucleotide binding; protein binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.