Recombinant Human TARDBP protein, His-tagged
| Cat.No. : | TARDBP-3014H |
| Product Overview : | Recombinant Human TARDBP protein(Q13148)(25-181aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 25-181aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 21.8 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | TVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSK |
| Gene Name | TARDBP TAR DNA binding protein [ Homo sapiens ] |
| Official Symbol | TARDBP |
| Synonyms | TARDBP; TAR DNA binding protein; TAR DNA-binding protein 43; ALS10; TDP 43; TAR DNA-binding protein-43; TDP-43; |
| Gene ID | 23435 |
| mRNA Refseq | NM_007375 |
| Protein Refseq | NP_031401 |
| MIM | 605078 |
| UniProt ID | Q13148 |
| ◆ Recombinant Proteins | ||
| TARDBP-39H | Recombinant Human TARDBP protein, GST-tagged | +Inquiry |
| TARDBP-41H | Recombinant Human TARDBP Protein (Full length), N-GST-tagged | +Inquiry |
| TARDBP-7588H | Recombinant Human TARDBP, His-tagged | +Inquiry |
| TARDBP-5776H | Recombinant Human TARDBP Protein (Ser104-Pro262), N-His tagged | +Inquiry |
| Tardbp-2006M | Recombinant Mouse Tardbp protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TARDBP-1251HCL | Recombinant Human TARDBP 293 Cell Lysate | +Inquiry |
| TARDBP-307HKCL | Human TARDBP Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TARDBP Products
Required fields are marked with *
My Review for All TARDBP Products
Required fields are marked with *



