Recombinant Human TAU protein, GST-tagged
| Cat.No. : | TAU-301315H |
| Product Overview : | Recombinant Human TAU (4-208 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Pro4-Leu208 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | PRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | MAPT microtubule associated protein tau [ Homo sapiens (human) ] |
| Official Symbol | TAU |
| Synonyms | MAPT; MSTD; PPND; DDPAC; MAPTL; MTBT1; MTBT2; tau-40; FTDP-17; PPP1R103 |
| Gene ID | 4137 |
| mRNA Refseq | NM_001123066 |
| Protein Refseq | NP_001116538 |
| MIM | 157140 |
| UniProt ID | P10636 |
| ◆ Recombinant Proteins | ||
| MAPT-172H | Recombinant Human Tau-441 (231-441) | +Inquiry |
| MAPT-2891H | Recombinant Human MAPT protein(1-441 aa, Tau231), C-His-tagged | +Inquiry |
| MAPT-121H | Recombinant Human Tau-441 (1-391) | +Inquiry |
| MAPT-4383H | Recombinant Human MAPT protein, His-tagged | +Inquiry |
| MAPT-39H | Recombinant Human MAPT Protein (216-391), N-AVI-tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MAPT-4477HCL | Recombinant Human MAPT 293 Cell Lysate | +Inquiry |
| MAPT-4478HCL | Recombinant Human MAPT 293 Cell Lysate | +Inquiry |
| MAPT-4476HCL | Recombinant Human MAPT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAPT Products
Required fields are marked with *
My Review for All MAPT Products
Required fields are marked with *
