Recombinant Human TBCEL protein, His-SUMO-tagged
Cat.No. : | TBCEL-4523H |
Product Overview : | Recombinant Human TBCEL protein(Q5QJ74)(1-424aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-424aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 64.2 kDa |
AA Sequence : | MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSNPLNLSVLERTCAGSFSGVRKLVLNNSKASWETVHMILQELPDLEELFLCLNDYETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPDDSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQLKTLVQLPTSNMLLYYFDHEAPFGPEEMKYSSRALHSFGIRDGDKIYVESKTK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TBCEL tubulin folding cofactor E-like [ Homo sapiens ] |
Official Symbol | TBCEL |
Synonyms | TBCEL; tubulin folding cofactor E-like; leucine rich repeat containing 35 , LRRC35, tubulin specific chaperone e like; tubulin-specific chaperone cofactor E-like protein; MGC10233; E-like; catastrophin; leucine rich repeat containing 35; tubulin-specific chaperone e-like; leucine-rich repeat-containing protein 35; El; LRRC35; FLJ14177; |
Gene ID | 219899 |
mRNA Refseq | NM_001130047 |
Protein Refseq | NP_001123519 |
MIM | 610451 |
UniProt ID | Q5QJ74 |
◆ Recombinant Proteins | ||
TBCEL-3709H | Recombinant Human TBCEL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TBCEL-5969R | Recombinant Rat TBCEL Protein | +Inquiry |
TBCEL-16509M | Recombinant Mouse TBCEL Protein | +Inquiry |
TBCEL-6087H | Recombinant Human TBCEL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TBCEL-4641R | Recombinant Rhesus monkey TBCEL Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBCEL-1215HCL | Recombinant Human TBCEL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TBCEL Products
Required fields are marked with *
My Review for All TBCEL Products
Required fields are marked with *
0
Inquiry Basket