Recombinant Human TBX21 protein, T7/His-tagged
| Cat.No. : | TBX21-195H |
| Product Overview : | Recombinant human T-bet cDNA (535aa, which derived from BC039739) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Form : | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFGIVEPGCGDMLTGTEPMPGSDEGRAPGADPQHRYFYPEPGAQDADE RRGGGSLGSPYPGGALVPAPPSRFLGAYAYPPRPQAAGFPGAGESFPPPADAEGYQPGEGYAAPDPRAGLYPGPR EDYALPAGLEVSGKLRVALNNHLLWSKFNQHQTEMIITKQGRRMFPFLSFTVAGLEPTSHYRMFVDVVLVDQHHW RYQSGKWVQCGKAEGSMPGNRLYVHPDSPNTGAHWMRQEVSFGKLKLTNNKGASNNVTQMIVLQSLHKYQPRLHI VEVNDGEPEAACNASNTHIFTFQETQFIAVTAYQNAEITQLKIDNNPFAKGFRENFESMYTSVDTSIPSPPGPNC QFLGGDHYSPLLPNQYPVPSRFYPDLPGQAKDVVPQAYWLGAPRDHSYEAEFRAVSMKPAFLPSAPGPTMSYYRG QEVLAPGAGWPVAPQYPPKMGPASWFRPMRTLPMEPGPGGSEGRGPEDQGPPLVWTEIAPIRPESSDSGLGEGDS KRRRVSPYPSSGDSSSPAGAPSPFDKEAEGQFYNYFPN |
| Purity : | >90% by SDS-PAGE. |
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Gene Name | TBX21 T-box 21 [ Homo sapiens ] |
| Official Symbol | TBX21 |
| Synonyms | TBX21; T-box 21; T-box transcription factor TBX21; T bet; TBLYM; T-box protein 21; T-box expressed in T cells; transcription factor TBLYM; TBET; T-PET; T-bet; |
| Gene ID | 30009 |
| mRNA Refseq | NM_013351 |
| Protein Refseq | NP_037483 |
| MIM | 604895 |
| UniProt ID | Q9UL17 |
| Chromosome Location | 17q21.2 |
| Pathway | Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Glucocorticoid receptor regulatory network, organism-specific biosystem; IL12 signaling mediated by STAT4, organism-specific biosystem; IL12-mediated signaling events, organism-specific biosystem; IL27-mediated signaling events, organism-specific biosystem; |
| Function | DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding; |
| ◆ Recombinant Proteins | ||
| TBX21-79H | Recombinant Human TBX21 Protein, His-tagged | +Inquiry |
| TBX21-5839H | Recombinant Human TBX21 Protein (Met11-Asn535), C-His tagged | +Inquiry |
| TBX21-2143H | Recombinant Human TBX21 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TBX21-125HFL | Active Recombinant Full Length Human TBX21 Protein, C-Flag-tagged | +Inquiry |
| Tbx21-6321M | Recombinant Mouse Tbx21 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TBX21-1747HCL | Recombinant Human TBX21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TBX21 Products
Required fields are marked with *
My Review for All TBX21 Products
Required fields are marked with *
