Recombinant Human TCAF1 Protein, GST-tagged
Cat.No. : | TCAF1-3679H |
Product Overview : | Human FAM115A full-length ORF ( NP_055534.1, 1 a.a. - 921 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | TCAF1 (TRPM8 Channel Associated Factor 1) is a Protein Coding gene. GO annotations related to this gene include ion channel binding. An important paralog of this gene is TCAF2. |
Molecular Mass : | 128.5 kDa |
AA Sequence : | MATPSAAFEALMNGVTSWDVPEDAVPCELLLIGEASFPVMVNDMGQVLIAASSYGRGRLVVVSHEDYLVEAQLTPFLLNAVGWLCSSPGAPIGVHPSLAPLAKILEGSGVDAKVEPEVKDSLGVYCIDAYNETMTEKLVKFMKCGGGLLIGGQAWDWANQGEDERVLFTFPGNLVTSVAGIYFTDNKGDTSFFKVSKKMPKIPVLVSCEDDLSDDREELLHGISELDISNSDCFPSQLLVHGALAFPLGLDSYHGCVIAAARYGRGRVVVTGHKVLFTVGKLGPFLLNAVRWLDGGRRGKIVVQTELRTLSGLLAVGGIDTSIEPNLTSDASVYCFEPVSEVGVKELQEFVAEGGGLFVGAQAWWWAFKNPGVSPLARFPGNLLLNPFGISITSQSLNPGPFRTPKAGIRTYHFRSTLAEFQVIMGRKRGNVEKGWLAKLGPDGAAFLQIPAEEIPAYMSVHRLLRKLLSRYRLPVATRENPVINDCCRGAMLSLATGLAHSGSDLSLLVPEIEDMYSSPYLRPSESPITVEVNCTNPGTRYCWMSTGLYIPGRQIIEVSLPEAAASADLKIQIGCHTDDLTRASKLFRGPLVINRCCLDKPTKSITCLWGGLLYIIVPQNSKLGSVPVTVKGAVHAPYYKLGETTLEEWKRRIQENPGPWGELATDNIILTVPTANLRTLENPEPLLRLWDEVMQAVARLGAEPFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQELINEKLIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIPRSRANIALWPPVREKRVRIYLSKGPNVKNWNAWTALETYLQLQEAFGWEPFIRLFTEYRNQTNLPTENVDKMNLWVKMFSHQVQKNLAPFFEAWAWPIQKEVATSLAYLPEWKENIMKLYLLTQMPH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TCAF1 TRPM8 channel associated factor 1 [ Homo sapiens (human) ] |
Official Symbol | TCAF1 |
Synonyms | family with sequence similarity 115, member A; 22201; Ensembl:ENSG00000198420; FLJ56782, KIAA0738; protein FAM115A; TCAF1; TRPM8 channel associated factor 1 |
Gene ID | 9747 |
mRNA Refseq | NM_001206938 |
Protein Refseq | NP_001193867 |
MIM | 616251 |
UniProt ID | Q9Y4C2 |
◆ Recombinant Proteins | ||
TCAF1-412H | Recombinant Human TCAF1 Protein, MYC/DDK-tagged | +Inquiry |
Tcaf1-6326M | Recombinant Mouse Tcaf1 Protein, Myc/DDK-tagged | +Inquiry |
Tcaf1-05M | Recombinant Mouse Tcaf1 Protein, C-MYC/DDK-tagged | +Inquiry |
TCAF1-3679H | Recombinant Human TCAF1 Protein, GST-tagged | +Inquiry |
TCAF1-4477HF | Recombinant Full Length Human TCAF1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TCAF1 Products
Required fields are marked with *
My Review for All TCAF1 Products
Required fields are marked with *