Recombinant Human TCAF1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TCAF1-4927H |
Product Overview : | FAM115A MS Standard C13 and N15-labeled recombinant protein (NP_055534) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | TCAF1 (TRPM8 Channel Associated Factor 1) is a Protein Coding gene. Diseases associated with TCAF1 include Lymph Node Carcinoma. Gene Ontology (GO) annotations related to this gene include ion channel binding. An important paralog of this gene is TCAF2. |
Molecular Mass : | 102 kDa |
AA Sequence : | MATPSAAFEALMNGVTSWDVPEDAVPCELLLIGEASFPVMVNDMGQVLIAASSYGRGRLVVVSHEDYLVEAQLTPFLLNAVGWLCSSPGAPIGVHPSLAPLAKILEGSGVDAKVEPEVKDSLGVYCIDAYNETMTEKLVKFMKCGGGLLIGGQAWDWANQGEDERVLFTFPGNLVTSVAGIYFTDNKGDTSFFKVSKKMPKIPVLVSCEDDLSDDREELLHGISELDISNSDCFPSQLLVHGALAFPLGLDSYHGCVIAAARYGRGRVVVTGHKVLFTVGKLGPFLLNAVRWLDGGRRGKIVVQTELRTLSGLLAVGGIDTSIEPNLTSDASVYCFEPVSEVGVKELQEFVAEGGGLFVGAQAWWWAFKNPGVSPLARFPGNLLLNPFGISITSQSLNPGPFRTPKAGIRTYHFRSTLAEFQVIMGRKRGNVEKGWLAKLGPDGAAFLQIPAEEIPAYMSVHRLLRKLLSRYRLPVATRENPVINDCCRGAMLSLATGLAHSGSDLSLLVPEIEDMYSSPYLRPSESPITVEVNCTNPGTRYCWMSTGLYIPGRQIIEVSLPEAAASADLKIQIGCHTDDLTRASKLFRGPLVINRCCLDKPTKSITCLWGGLLYIIVPQNSKLGSVPVTVKGAVHAPYYKLGETTLEEWKRRIQENPGPWGELATDNIILTVPTANLRTLENPEPLLRLWDEVMQAVARLGAEPFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQELINEKLIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIPRSRANIALWPPVREKRVRIYLSKGPNVKNWNAWTALETYLQLQEAFGWEPFIRLFTEYRNQTNLPTENVDKMNLWVKMFSHQVQKNLAPFFEAWAWPIQKEVATSLAYLPEWKENIMKLYLLTQMPHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TCAF1 TRPM8 channel associated factor 1 [ Homo sapiens (human) ] |
Official Symbol | TCAF1 |
Synonyms | TCAF1; TRPM8 channel associated factor 1; FAM115A; TRPM8 channel-associated factor 1; TRP channel-associated factor 1; family with sequence similarity 115, member A; protein FAM115A |
Gene ID | 9747 |
mRNA Refseq | NM_014719 |
Protein Refseq | NP_055534 |
MIM | 616251 |
UniProt ID | Q9Y4C2 |
◆ Recombinant Proteins | ||
TCAF1-412H | Recombinant Human TCAF1 Protein, MYC/DDK-tagged | +Inquiry |
TCAF1-3679H | Recombinant Human TCAF1 Protein, GST-tagged | +Inquiry |
TCAF1-4477HF | Recombinant Full Length Human TCAF1 Protein, GST-tagged | +Inquiry |
TCAF1-4927H | Recombinant Human TCAF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Tcaf1-6326M | Recombinant Mouse Tcaf1 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TCAF1 Products
Required fields are marked with *
My Review for All TCAF1 Products
Required fields are marked with *
0
Inquiry Basket