Recombinant Human TCEB2 protein, His-tagged

• Cat.No.: TCEB2-3078H
• Product Overview: Recombinant Human TCEB2 protein(1-118 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-118 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: TCEB2 transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B) [ Homo sapiens ]
• Official Symbol: TCEB2
• Synonyms: TCEB2; transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B); transcription elongation factor B (SIII), polypeptide 2 (18kD, elongin B); transcription elongation factor B polypeptide 2; SIII; SIII p18; elongin-B; elongin 18 kDa subunit; elongin, 18-kD subunit; RNA polymerase II transcription factor SIII subunit B; RNA polymerase II transcription factor SIII p18 subunit; ELOB
• Gene ID: 6923
• mRNA Refseq: NM_007108
• Protein Refseq: NP_009039
• MIM: 600787
• UniProt ID: Q15370