Recombinant Human TCEB2 protein, His-tagged

Cat.No. : TCEB2-3078H
Product Overview : Recombinant Human TCEB2 protein(1-118 aa), fused to His tag, was expressed in E. coli.
Availability May 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-118 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name TCEB2 transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B) [ Homo sapiens ]
Official Symbol TCEB2
Synonyms TCEB2; transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B); transcription elongation factor B (SIII), polypeptide 2 (18kD, elongin B); transcription elongation factor B polypeptide 2; SIII; SIII p18; elongin-B; elongin 18 kDa subunit; elongin, 18-kD subunit; RNA polymerase II transcription factor SIII subunit B; RNA polymerase II transcription factor SIII p18 subunit; ELOB;
Gene ID 6923
mRNA Refseq NM_007108
Protein Refseq NP_009039
MIM 600787
UniProt ID Q15370

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TCEB2 Products

Required fields are marked with *

My Review for All TCEB2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon