Recombinant Human TCL1B Protein, His-tagged
| Cat.No. : | TCL1B-320H |
| Product Overview : | Recombinant Human TCL1B Protein, His-tagged,expressed in E. coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-128 aa |
| Description : | TCL1B belongs to the TCL1 family and is expressed in a variety of tissues including placenta and testis. This protein enhances the phosphorylation and activation of AKT1 and AKT2. Recombinant human TCL1B protein, fused to His-tag, was expressed in E.coli and purified by using conventional chromatography techniques. |
| Tag : | His |
| Molecular Mass : | 16 kDa |
| AA Sequence : | MASEASVRLGVPPGRLWIQRPGIYEDEEGRTWVTVVVRFNPSRREWARASQGSRYEPSITVHLWQMAVHTRELLSSGQMPFSQLPAVWQLYPRRKYRAADSSFWEIADHGQIDSMEQLVLTYQPERKDHHHHHHHH |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.77mg/ml by BCA |
| Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose |
| Gene Name | TCL1B TCL1 family AKT coactivator B [ Homo sapiens (human) ] |
| Official Symbol | TCL1B |
| Synonyms | TCL1B; T-cell leukemia/lymphoma 1B; T-cell leukemia/lymphoma protein 1B; TML1; oncogene TCL-1B; TCL1/ MTCP1-like 1; T-cell lymphoma/leukemia 1B; syncytiotrophoblast-specific protein; SYN-1 |
| Gene ID | 9623 |
| mRNA Refseq | NM_004918 |
| Protein Refseq | NP_004909 |
| MIM | 603769 |
| UniProt ID | O95988 |
| ◆ Recombinant Proteins | ||
| TCL1B-5661H | Recombinant Human TCL1B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TCL1B-320H | Recombinant Human TCL1B Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TCL1B-1173HCL | Recombinant Human TCL1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TCL1B Products
Required fields are marked with *
My Review for All TCL1B Products
Required fields are marked with *
