Recombinant Human TCL1B Protein, His-tagged

Cat.No. : TCL1B-320H
Product Overview : Recombinant Human TCL1B Protein, His-tagged,expressed in E. coli.
Availability December 07, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 2-128 aa
Description : TCL1B belongs to the TCL1 family and is expressed in a variety of tissues including placenta and testis. This protein enhances the phosphorylation and activation of AKT1 and AKT2. Recombinant human TCL1B protein, fused to His-tag, was expressed in E.coli and purified by using conventional chromatography techniques.
Tag : His
Molecular Mass : 16 kDa
AA Sequence : MASEASVRLGVPPGRLWIQRPGIYEDEEGRTWVTVVVRFNPSRREWARASQGSRYEPSITVHLWQMAVHTRELLSSGQMPFSQLPAVWQLYPRRKYRAADSSFWEIADHGQIDSMEQLVLTYQPERKDHHHHHHHH
Purity : >90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.77mg/ml by BCA
Storage Buffer : Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose
Gene Name TCL1B TCL1 family AKT coactivator B [ Homo sapiens (human) ]
Official Symbol TCL1B
Synonyms TCL1B; T-cell leukemia/lymphoma 1B; T-cell leukemia/lymphoma protein 1B; TML1; oncogene TCL-1B; TCL1/ MTCP1-like 1; T-cell lymphoma/leukemia 1B; syncytiotrophoblast-specific protein; SYN-1
Gene ID 9623
mRNA Refseq NM_004918
Protein Refseq NP_004909
MIM 603769
UniProt ID O95988

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TCL1B Products

Required fields are marked with *

My Review for All TCL1B Products

Required fields are marked with *

0
cart-icon
0
compare icon