"TDGF1" Related Products

Expand

Recombinant Human TDGF1 protein, T7/His-tagged

Cat.No.: TDGF1-78H
Product Overview: Recombinant human Cripto-1 cDNA (31-150aa, isoform-1, derived from BC067844) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
Bio-activity: Measured by its binding ability in a functional ELSA. Immobilized recombinant human Nodal protein at 2ug/ml (100ul/well) can bind rhCripto-1 with a linear range of 0.5-100 ng/ml.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFLGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSK ELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro Cripto-1/Nodal signaling pathway regulations study for mesoderm differentiation.2. Potential biomarker protein for various cancer diagnostic developments.3. May be used as antigen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: TDGF1 teratocarcinoma-derived growth factor 1 [ Homo sapiens ]
Official Symbol: TDGF1
Synonyms: TDGF1; teratocarcinoma-derived growth factor 1; CR; CRIPTO; Cripto 1; cripto-1 growth factor; epidermal growth factor-like cripto protein CR1; CRGF;
Gene ID: 6997
mRNA Refseq: NM_001174136
Protein Refseq: NP_001167607
MIM:
UniProt ID: P13385
Chromosome Location: 3p21.31
Pathway: Developmental Biology, organism-specific biosystem; Glypican 1 network, organism-specific biosystem; Regulation of Signaling by NODAL, organism-specific biosystem; Signaling by NODAL, organism-specific biosystem;
Function: growth factor activity; protein binding; receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.