Recombinant Human TEAD4 protein, His-tagged
| Cat.No. : | TEAD4-4396H |
| Product Overview : | Recombinant Human TEAD4 protein(Q15561)(74-434aa), fused to N-terminal His tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 74-434aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 44.7 kDa |
| AA Sequence : | MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | TEAD4 TEA domain family member 4 [ Homo sapiens ] |
| Official Symbol | TEAD4 |
| Synonyms | TEAD4; TEA domain family member 4; TCF13L1; transcriptional enhancer factor TEF-3; EFTR 2; RTEF 1; TEF 3; TEFR 1; transcription factor RTEF-1; transcription factor 13-like 1; transcriptional enhancer factor 3; related transcription enhancer factor 1B; transcriptional enhancer factor 1-related; TEF3; RTEF1; TEF-3; EFTR-2; TEFR-1; hRTEF-1B; MGC9014; |
| Gene ID | 7004 |
| mRNA Refseq | NM_003213 |
| Protein Refseq | NP_003204 |
| MIM | 601714 |
| UniProt ID | Q15561 |
| ◆ Recombinant Proteins | ||
| TEAD4-4602H | Recombinant Human TEAD4 protein, His-tagged | +Inquiry |
| TEAD4-3175H | Recombinant Human TEAD4 protein, GST-tagged | +Inquiry |
| TEAD4-4397H | Recombinant Human TEAD4 protein, GST-tagged | +Inquiry |
| TEAD4-4585H | Recombinant Human TEAD4 protein, His&Myc-tagged | +Inquiry |
| TEAD4-9116M | Recombinant Mouse TEAD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TEAD4-1758HCL | Recombinant Human TEAD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TEAD4 Products
Required fields are marked with *
My Review for All TEAD4 Products
Required fields are marked with *
