Recombinant Human TFAP2A protein, His-tagged
| Cat.No. : | TFAP2A-3351H |
| Product Overview : | Recombinant Human TFAP2A protein(79-431 aa), fused to His tag, was expressed in E. coli. |
| Availability | February 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 79-431 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | TFAP2A transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha) [ Homo sapiens ] |
| Official Symbol | TFAP2A |
| Synonyms | TFAP2A; transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha); AP2TF, TFAP2, transcription factor AP 2 alpha (activating enhancer binding protein 2 alpha); transcription factor AP-2-alpha; AP 2; AP2-alpha; activator protein 2; AP-2 transcription factor; activating enhancer-binding protein 2-alpha; AP-2; BOFS; AP2TF; TFAP2; AP-2alpha; FLJ51761; |
| Gene ID | 7020 |
| mRNA Refseq | NM_001032280 |
| Protein Refseq | NP_001027451 |
| MIM | 107580 |
| UniProt ID | P05549 |
| ◆ Recombinant Proteins | ||
| TFAP2A-9570Z | Recombinant Zebrafish TFAP2A | +Inquiry |
| TFAP2A-6651C | Recombinant Chicken TFAP2A | +Inquiry |
| TFAP2A-2591M | Recombinant Mouse TFAP2A Protein (1-437 aa), His-Myc-tagged | +Inquiry |
| TFAP2A-144H | Recombinant Human TFAP2A | +Inquiry |
| TFAP2A-4179H | Recombinant Human TFAP2A Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TFAP2A-664HCL | Recombinant Human TFAP2A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TFAP2A Products
Required fields are marked with *
My Review for All TFAP2A Products
Required fields are marked with *
