Recombinant Human TFAP2B protein, His-tagged
Cat.No. : | TFAP2B-3653H |
Product Overview : | Recombinant Human TFAP2B protein(111-460 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 111-460 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | RQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMGDSLSLHGLGHPGMEDVQSVEDANNSGMNLLDQSVIKKVPVPPKSVTSLMMNKDGFLGGMSVNTGEVFCSVPGRLSLLSSTSKYKVTVGEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLRERLEKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYICETEFPAKAVSEYLNRQHTDPSDLHSRKNMLLATKQLCKEFTDLLAQDRTPIGNSRPSPILEPGIQSCLTHFSLITHGFGAPAICAALTALQNYLTEALKGMDKMFLNNTTTNRHTSGEGPGSKTGDKEEKHRK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | TFAP2B transcription factor AP-2 beta (activating enhancer binding protein 2 beta) [ Homo sapiens ] |
Official Symbol | TFAP2B |
Synonyms | TFAP2B; transcription factor AP-2 beta (activating enhancer binding protein 2 beta); transcription factor AP 2 beta (activating enhancer binding protein 2 beta); transcription factor AP-2-beta; AP2 B; AP2-beta; activating enhancer binding protein 2 beta; activating enhancer-binding protein 2-beta; AP-2B; AP2-B; MGC21381; |
Gene ID | 7021 |
mRNA Refseq | NM_003221 |
Protein Refseq | NP_003212 |
MIM | 601601 |
UniProt ID | Q92481 |
◆ Recombinant Proteins | ||
TFAP2B-3653H | Recombinant Human TFAP2B protein, His-tagged | +Inquiry |
TFAP2B-6457C | Recombinant Chicken TFAP2B | +Inquiry |
TFAP2B-3056Z | Recombinant Zebrafish TFAP2B | +Inquiry |
TFAP2B-586H | Recombinant Human TFAP2B Protein, His-tagged | +Inquiry |
TFAP2B-2570Z | Recombinant Zebrafish TFAP2B | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TFAP2B Products
Required fields are marked with *
My Review for All TFAP2B Products
Required fields are marked with *