Recombinant Human TFAP2B protein, His-tagged

• Cat.No.: TFAP2B-3653H
• Product Overview: Recombinant Human TFAP2B protein(111-460 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 111-460 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: RQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMGDSLSLHGLGHPGMEDVQSVEDANNSGMNLLDQSVIKKVPVPPKSVTSLMMNKDGFLGGMSVNTGEVFCSVPGRLSLLSSTSKYKVTVGEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLRERLEKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYICETEFPAKAVSEYLNRQHTDPSDLHSRKNMLLATKQLCKEFTDLLAQDRTPIGNSRPSPILEPGIQSCLTHFSLITHGFGAPAICAALTALQNYLTEALKGMDKMFLNNTTTNRHTSGEGPGSKTGDKEEKHRK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: TFAP2B transcription factor AP-2 beta (activating enhancer binding protein 2 beta) [ Homo sapiens ]
• Official Symbol: TFAP2B
• Synonyms: TFAP2B; transcription factor AP-2 beta (activating enhancer binding protein 2 beta); transcription factor AP 2 beta (activating enhancer binding protein 2 beta); transcription factor AP-2-beta; AP2 B; AP2-beta; activating enhancer binding protein 2 beta; activating enhancer-binding protein 2-beta; AP-2B; AP2-B; MGC21381
• Gene ID: 7021
• mRNA Refseq: NM_003221
• Protein Refseq: NP_003212
• MIM: 601601
• UniProt ID: Q92481