Active Recombinant Full Length Human TFF1 protein, Tag Free
Cat.No. : | TFF1-244H |
Product Overview : | Recombinant Human TFF1 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 1-84 a.a. |
Description : | Trefoil factor 1 belongs to the trefoil factor family that consists of three members named TFF1, TFF2 and TFF3. They are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. The TFFs are stable secretory proteins expressed highly in the gastrointestinal tract (gastric mucosa). TFF1 is an essential protein for normal differentiation of the antral and pyloric gastric mucosa and functions as a stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. It is studied because of commonly expressed in tumors as well. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human MCF-7 cells is less than 10 μg/ml, corresponding to a specific activity of > 100 IU/mg. |
Molecular Mass : | Approximately 13.2 kDa, a homodimer consisting of two 60 amino acid polypeptide chains, which includes a 40-amino acid trefoil motif containing three conserved intramolecular disulfide bonds. |
AA Sequence : | EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF |
Endotoxin : | Less than 1 EU/µg of rHuTFF1 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | TFF1 |
Official Symbol | TFF1 |
Synonyms | TFF1; trefoil factor 1; BCEI, breast cancer, estrogen inducible sequence expressed in; D21S21; HP1.A; HPS2; pNR 2; pS2; protein pS2; polypeptide P1.A; gastrointestinal trefoil protein pS2; breast cancer estrogen-inducible protein; breast cancer estrogen-inducible sequence; BCEI; pNR-2; |
Gene ID | 7031 |
mRNA Refseq | NM_003225 |
Protein Refseq | NP_003216 |
MIM | 113710 |
UniProt ID | P04155 |
◆ Recombinant Proteins | ||
TFF1-27975TH | Recombinant Human TFF1, His-tagged | +Inquiry |
TFF1-1142H | Recombinant Human TFF1 Protein (Met1-Phe84), His-tagged | +Inquiry |
TFF1-6417H | Recombinant Human TFF1 Protein (Met1-Phe84), N-His tagged | +Inquiry |
TFF1-27976TH | Recombinant Human TFF1 | +Inquiry |
TFF1-204H | Recombinant Human TFF1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFF1-1127HCL | Recombinant Human TFF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TFF1 Products
Required fields are marked with *
My Review for All TFF1 Products
Required fields are marked with *
0
Inquiry Basket