"TFF1" Related Products

Expand

Recombinant Human TFF1 protein, His-tagged

Cat.No.: TFF1-204H
Product Overview: Recombinant human TFF1 cDNA (25 – 84aa) fused with Alpha-Fetal Protein N-terminal domain (AFPn)-His-TEV cleavage site (219aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPA FLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSGGSHHHHHHGSENLYFQGEFEAQTET CTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
Purity: >90% by SDS-PAGE.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: TFF1 trefoil factor 1 [ Homo sapiens ]
Official Symbol: TFF1
Synonyms: TFF1; trefoil factor 1; BCEI, breast cancer, estrogen inducible sequence expressed in; D21S21; HP1.A; HPS2; pNR 2; pS2; protein pS2; polypeptide P1.A; BCEI; pNR-2;
Gene ID: 7031
mRNA Refseq: NM_003225
Protein Refseq: NP_003216
MIM: 113710
UniProt ID: P04155
Chromosome Location: 21q22.3
Pathway: FOXA1 transcription factor network, organism-specific biosystem;
Function: growth factor activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.