Recombinant Human TFF1 protein, His-tagged
Cat.No. : | TFF1-204H |
Product Overview : | Recombinant human TFF1 cDNA (25 – 84aa) fused with Alpha-Fetal Protein N-terminal domain (AFPn)-His-TEV cleavage site (219aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-84 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPA FLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSGGSHHHHHHGSENLYFQGEFEAQTET CTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | TFF1 trefoil factor 1 [ Homo sapiens ] |
Official Symbol | TFF1 |
Synonyms | TFF1; trefoil factor 1; BCEI, breast cancer, estrogen inducible sequence expressed in; D21S21; HP1.A; HPS2; pNR 2; pS2; protein pS2; polypeptide P1.A; BCEI; pNR-2; |
Gene ID | 7031 |
mRNA Refseq | NM_003225 |
Protein Refseq | NP_003216 |
MIM | 113710 |
UniProt ID | P04155 |
Chromosome Location | 21q22.3 |
Pathway | FOXA1 transcription factor network, organism-specific biosystem; |
Function | growth factor activity; protein binding; |
◆ Recombinant Proteins | ||
TFF1-27975TH | Recombinant Human TFF1, His-tagged | +Inquiry |
Tff1-1436M | Recombinant Mouse Tff1 protein, His & GST-tagged | +Inquiry |
Tff1-1437R | Recombinant Rat Tff1 protein, His & T7-tagged | +Inquiry |
TFF1-5443H | Recombinant Human TFF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TFF1-050T | Active Recombinant Human TFF1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFF1-1127HCL | Recombinant Human TFF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TFF1 Products
Required fields are marked with *
My Review for All TFF1 Products
Required fields are marked with *
0
Inquiry Basket