| Species : |
Human |
| Source : |
Baculovirus |
| Tag : |
His |
| Protein Length : |
Full Length |
| Description : |
This gene encodes a Kunitz-type serine protease inhibitor that regulates the tissue factor (TF)-dependent pathway of blood coagulation. The coagulation process initiates with the formation of a factor VIIa-TF complex, which proteolytically activates additional proteases (factors IX and X) and ultimately leads to the formation of a fibrin clot. The product of this gene inhibits the activated factor X and VIIa-TF proteases in an autoregulatory loop. Inhibition of the encoded protein restores hemostasis in animal models of hemophilia. This gene encodes multiple protein isoforms that differ in their inhibitory activity, specificity and cellular localization. |
| Form : |
Liquid |
| Molecular Mass : |
33 kDa (285aa) |
| AA Sequence : |
DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM |
| Endotoxin : |
< 1 EU/μg protein by LAL |
| Purity : |
> 90% as determined by SDS-PAGE |
| Applications : |
SDS-PAGE |
| Notes : |
For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
| Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade . Avoid repeated freezing and thawing cycles. |
| Concentration : |
0.25 mg/mL (determined by absorbance at 280nm) |
| Storage Buffer : |
Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
| References : |
1. Maroney SA., et al. (2010) Thromb Res. 1:S52-S56. 2. Ali HO., et al. (2016) PLoS One. 11:e0152114. |