Recombinant Human TFPI Protein, Full Length, C-His tagged

Cat.No. : TFPI-42FLH
Product Overview : Recombinant full length human TFPI, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Baculovirus
Tag : His
Protein Length : Full Length
Description : This gene encodes a Kunitz-type serine protease inhibitor that regulates the tissue factor (TF)-dependent pathway of blood coagulation. The coagulation process initiates with the formation of a factor VIIa-TF complex, which proteolytically activates additional proteases (factors IX and X) and ultimately leads to the formation of a fibrin clot. The product of this gene inhibits the activated factor X and VIIa-TF proteases in an autoregulatory loop. Inhibition of the encoded protein restores hemostasis in animal models of hemophilia. This gene encodes multiple protein isoforms that differ in their inhibitory activity, specificity and cellular localization.
Form : Liquid
Molecular Mass : 33 kDa (285aa)
AA Sequence : DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Endotoxin : < 1 EU/μg protein by LAL
Purity : > 90% as determined by SDS-PAGE
Applications : SDS-PAGE
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade . Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
References : 1. Maroney SA., et al. (2010) Thromb Res. 1:S52-S56.
2. Ali HO., et al. (2016) PLoS One. 11:e0152114.
Gene Name TFPI tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) [ Homo sapiens (human) ]
Official Symbol TFPI
Synonyms TFPI; tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor); LACI; tissue factor pathway inhibitor; EPI; extrinsic pathway inhibitor; TFI; TFPI1; anti-convertin
Gene ID 7035
mRNA Refseq NM_006287
Protein Refseq NP_006278
MIM 152310
UniProt ID P10646

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TFPI Products

Required fields are marked with *

My Review for All TFPI Products

Required fields are marked with *

0

Inquiry Basket

cartIcon