Recombinant Human TGFA protein, His-tagged
Cat.No. : | TGFA-3032H |
Product Overview : | Recombinant Human TGFA protein(40-89 aa), fused to His tag, was expressed in E. coli. |
Availability | October 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 40-89 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAV |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TGFA transforming growth factor, alpha [ Homo sapiens ] |
Official Symbol | TGFA |
Synonyms | TGFA; transforming growth factor, alpha; protransforming growth factor alpha; TGF-alpha; TFGA; |
Gene ID | 7039 |
mRNA Refseq | NM_001099691 |
Protein Refseq | NP_001093161 |
MIM | 190170 |
UniProt ID | P01135 |
◆ Recombinant Proteins | ||
TGFa-1285R | Recombinant Rat TGFa protein, His-tagged | +Inquiry |
TGFA-522H | Recombinant Human TGFA protein, His & T7-tagged | +Inquiry |
TGFA-2763H | Recombinant Human TGFA Protein, His-tagged | +Inquiry |
TGFA-285H | Active Recombinant Human TGFA Protein (Trp40-Ala89), C-His tagged, Animal-free, Carrier-free | +Inquiry |
TGFa-149H | Active Recombinant Human TGFA protein | +Inquiry |
◆ Native Proteins | ||
TGFA-29704TH | Recombinant Human TGFA | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFA-1121HCL | Recombinant Human TGFA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TGFA Products
Required fields are marked with *
My Review for All TGFA Products
Required fields are marked with *