Recombinant Human TGFBR2 protein, Fc-tagged
Cat.No. : | TGFBR2-229H |
Product Overview : | Recombinant Human TGFBR2, transcript variant 2, fused with Fc tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Description : | This gene encodes a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. The encoded protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different isoforms have been characterized |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH7.2 |
Molecular Mass : | 42.6kD |
AA Sequence : | TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | TGFBR2 transforming growth factor, beta receptor II (70/80kDa) [ Homo sapiens ] |
Official Symbol | TGFBR2 |
Synonyms | TGFBR2; transforming growth factor, beta receptor II (70/80kDa); MFS2, transforming growth factor, beta receptor II (70 80kD); TGF-beta receptor type-2; tbetaR-II; TGF-beta receptor type II; TGF-beta type II receptor; TGF-beta receptor type IIB; transforming growth factor-beta receptor type II; transforming growth factor beta receptor type IIC; transforming growth factor, beta receptor II (70/80kDa) isoform 1; transforming growth factor, beta receptor II (70/80kDa) isoform 2; AAT3; FAA3; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TGFR-2; TGFbeta-RII; |
Gene ID | 7048 |
mRNA Refseq | NM_003242 |
Protein Refseq | NP_003233 |
MIM | 190182 |
UniProt ID | P37173 |
◆ Recombinant Proteins | ||
Tgfbr2-3573R | Recombinant Rat Tgfbr2 protein, His&Myc-tagged | +Inquiry |
TGFBR2-237H | Recombinant Human TGFBR2 Protein, Ile24-Asp159, C-mFc-Avi tagged, Biotinylated | +Inquiry |
TGFBR2-1684H | Recombinant Human Transforming Growth Factor, Beta Receptor II (70/80kDa) | +Inquiry |
TGFBR2-151H | Recombinant Human TGFBR2, Fc Chimera | +Inquiry |
Tgfbr2-6393M | Recombinant Mouse Tgfbr2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFBR2-1374RCL | Recombinant Rat TGFBR2 cell lysate | +Inquiry |
TGFBR2-2842HCL | Recombinant Human TGFBR2 cell lysate | +Inquiry |
TGFBR2-1291CCL | Recombinant Cynomolgus TGFBR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TGFBR2 Products
Required fields are marked with *
My Review for All TGFBR2 Products
Required fields are marked with *