Recombinant Human TGFBR2 protein, His&Myc-tagged

Cat.No. : TGFBR2-564H
Product Overview : Recombinant Human TGFBR2 protein(P37173)(23-166aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 23-166a.a.
Tag : His&Myc
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 23.8 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQ
Gene Name TGFBR2 transforming growth factor, beta receptor II (70/80kDa) [ Homo sapiens ]
Official Symbol TGFBR2
Synonyms TGFBR2; transforming growth factor, beta receptor II (70/80kDa); MFS2, transforming growth factor, beta receptor II (70 80kD); TGF-beta receptor type-2; tbetaR-II; TGF-beta receptor type II; TGF-beta type II receptor; TGF-beta receptor type IIB; transforming growth factor-beta receptor type II; transforming growth factor beta receptor type IIC; transforming growth factor, beta receptor II (70/80kDa) isoform 1; transforming growth factor, beta receptor II (70/80kDa) isoform 2; AAT3; FAA3; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TGFR-2; TGFbeta-RII;
Gene ID 7048
mRNA Refseq NM_001024847
Protein Refseq NP_001020018
MIM 190182
UniProt ID P37173

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TGFBR2 Products

Required fields are marked with *

My Review for All TGFBR2 Products

Required fields are marked with *

0
cart-icon
0
compare icon