Recombinant Human TGFBR2 protein, His&Myc-tagged

• Cat.No.: TGFBR2-564H
• Product Overview: Recombinant Human TGFBR2 protein(P37173)(23-166aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 23-166a.a.
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 23.8 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQ

Gene Information

• Gene Name: TGFBR2 transforming growth factor, beta receptor II (70/80kDa) [ Homo sapiens ]
• Official Symbol: TGFBR2
• Synonyms: TGFBR2; transforming growth factor, beta receptor II (70/80kDa); MFS2, transforming growth factor, beta receptor II (70 80kD); TGF-beta receptor type-2; tbetaR-II; TGF-beta receptor type II; TGF-beta type II receptor; TGF-beta receptor type IIB; transforming growth factor-beta receptor type II; transforming growth factor beta receptor type IIC; transforming growth factor, beta receptor II (70/80kDa) isoform 1; transforming growth factor, beta receptor II (70/80kDa) isoform 2; AAT3; FAA3; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TGFR-2; TGFbeta-RII
• Gene ID: 7048
• mRNA Refseq: NM_001024847
• Protein Refseq: NP_001020018
• MIM: 190182
• UniProt ID: P37173