Recombinant Human TGFBR2 protein, His&Myc-tagged
Cat.No. : | TGFBR2-564H |
Product Overview : | Recombinant Human TGFBR2 protein(P37173)(23-166aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 23-166a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 23.8 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQ |
Gene Name | TGFBR2 transforming growth factor, beta receptor II (70/80kDa) [ Homo sapiens ] |
Official Symbol | TGFBR2 |
Synonyms | TGFBR2; transforming growth factor, beta receptor II (70/80kDa); MFS2, transforming growth factor, beta receptor II (70 80kD); TGF-beta receptor type-2; tbetaR-II; TGF-beta receptor type II; TGF-beta type II receptor; TGF-beta receptor type IIB; transforming growth factor-beta receptor type II; transforming growth factor beta receptor type IIC; transforming growth factor, beta receptor II (70/80kDa) isoform 1; transforming growth factor, beta receptor II (70/80kDa) isoform 2; AAT3; FAA3; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TGFR-2; TGFbeta-RII; |
Gene ID | 7048 |
mRNA Refseq | NM_001024847 |
Protein Refseq | NP_001020018 |
MIM | 190182 |
UniProt ID | P37173 |
◆ Recombinant Proteins | ||
TGFBR2-697H | Active Recombinant Human TGFBR2, Fc-tagged, Biotinylated | +Inquiry |
TGFBR2-05H | Recombinant Human TGFBR2 Protein, 23-166aa, C-hIgG-His tagged | +Inquiry |
Tgfbr2-3573R | Recombinant Rat Tgfbr2 protein, His&Myc-tagged | +Inquiry |
TGFBR2-159H | Recombinant Human TGFBR2 protein(Met1-Asp159), hFc-tagged | +Inquiry |
TGFBR2-028H | Recombinant Human transforming growth factor beta receptor 2 Protein, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFBR2-2842HCL | Recombinant Human TGFBR2 cell lysate | +Inquiry |
TGFBR2-1374RCL | Recombinant Rat TGFBR2 cell lysate | +Inquiry |
TGFBR2-1291CCL | Recombinant Cynomolgus TGFBR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TGFBR2 Products
Required fields are marked with *
My Review for All TGFBR2 Products
Required fields are marked with *
0
Inquiry Basket