Recombinant Human TGM1 protein, GST-tagged
| Cat.No. : | TGM1-1206H |
| Product Overview : | Recombinant Human TGM1 protein(467-817 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 467-817 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | SGIFCCGPCSVESIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAISSNMREDITYLYKHPEGSDAERKAVETAAAHGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLMVSVMLINHSSSRRTVKLHLYLSVTFYTGVSGTIFKETKKEVELAPGASDRVTMPVAYKEYRPHLVDQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQSFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPAPGDGGFFSDAGGDSHLGETIPMASRGGA |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | TGM1 transglutaminase 1 (K polypeptide epidermal type I, protein-glutamine-gamma-glutamyltransferase) [ Homo sapiens ] |
| Official Symbol | TGM1 |
| Synonyms | TGM1; transglutaminase 1 (K polypeptide epidermal type I, protein-glutamine-gamma-glutamyltransferase); ICR2; protein-glutamine gamma-glutamyltransferase K; LI; LI1; TGASE; TGK; TG(K); TGase K; TGase-1; epidermal TGase; transglutaminase K; transglutaminase-1; transglutaminase 1 isoform; transglutaminase, keratinocyte; KTG; |
| Gene ID | 7051 |
| mRNA Refseq | NM_000359 |
| Protein Refseq | NP_000350 |
| MIM | 190195 |
| UniProt ID | P22735 |
| ◆ Recombinant Proteins | ||
| TGM1-1420HFL | Recombinant Full Length Human TGM1 Protein, C-Flag-tagged | +Inquiry |
| TGM1-1206H | Recombinant Human TGM1 protein, GST-tagged | +Inquiry |
| Tgm1-6395M | Recombinant Mouse Tgm1 Protein, Myc/DDK-tagged | +Inquiry |
| TGM1-9166M | Recombinant Mouse TGM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TGM1-5698R | Recombinant Rat TGM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TGM1-1111HCL | Recombinant Human TGM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TGM1 Products
Required fields are marked with *
My Review for All TGM1 Products
Required fields are marked with *
