Recombinant Human TGM1 protein, GST-tagged

Cat.No. : TGM1-1206H
Product Overview : Recombinant Human TGM1 protein(467-817 aa), fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 467-817 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : SGIFCCGPCSVESIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAISSNMREDITYLYKHPEGSDAERKAVETAAAHGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLMVSVMLINHSSSRRTVKLHLYLSVTFYTGVSGTIFKETKKEVELAPGASDRVTMPVAYKEYRPHLVDQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQSFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPAPGDGGFFSDAGGDSHLGETIPMASRGGA
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name TGM1 transglutaminase 1 (K polypeptide epidermal type I, protein-glutamine-gamma-glutamyltransferase) [ Homo sapiens ]
Official Symbol TGM1
Synonyms TGM1; transglutaminase 1 (K polypeptide epidermal type I, protein-glutamine-gamma-glutamyltransferase); ICR2; protein-glutamine gamma-glutamyltransferase K; LI; LI1; TGASE; TGK; TG(K); TGase K; TGase-1; epidermal TGase; transglutaminase K; transglutaminase-1; transglutaminase 1 isoform; transglutaminase, keratinocyte; KTG;
Gene ID 7051
mRNA Refseq NM_000359
Protein Refseq NP_000350
MIM 190195
UniProt ID P22735

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TGM1 Products

Required fields are marked with *

My Review for All TGM1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon