Recombinant Human THAP11 protein, Arginine-tagged

Cat.No. : THAP11-142H
Product Overview : Recombinant human THAP11 protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Form : 0.40 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : GEFPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYT VRVPTIFPLRGVNERKVARRPAGAAAARRRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQSSPSASTAQTAQLQPN LVSASAAVLLTLQATVDSSQAPGSVQPAPITPTGEDVKPIDLTVQVEFAAAEGAAAAAAASELQAATAGLEAAEC PMGPQLVVVGEEGFPDTGSDHSYSLSSGTTEEELLRKLNEQRDILALMEVKMKEMKGSIRHLRLTEAKLREELRE KDRLLAMAVIRKKHGM
Purity : >90% by SDS-PAGE
Applications : 1. Protein transduction for human HSC cell differentiation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production.
Storage : Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name THAP11 THAP domain containing 11 [ Homo sapiens ]
Official Symbol THAP11
Synonyms THAP11; THAP domain containing 11; THAP domain-containing protein 11; CTG B43a; CTG B45d; HRIHFB2206; RONIN; CTG-B43a; CTG-B45d;
Gene ID 57215
mRNA Refseq NM_020457
Protein Refseq NP_065190
MIM 609119
UniProt ID Q96EK4
Chromosome Location 16q22.1
Function DNA binding; metal ion binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All THAP11 Products

Required fields are marked with *

My Review for All THAP11 Products

Required fields are marked with *

0
cart-icon