"THAP11" Related Products

Recombinant Human THAP11 protein, Arginine-tagged

Cat.No.: THAP11-142H
Product Overview: Recombinant human THAP11 protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli.
Source: E. coli
Species: Human
Tag: Arginine
Form: 0.40 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: GEFPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYT VRVPTIFPLRGVNERKVARRPAGAAAARRRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQSSPSASTAQTAQLQPN LVSASAAVLLTLQATVDSSQAPGSVQPAPITPTGEDVKPIDLTVQVEFAAAEGAAAAAAASELQAATAGLEAAEC PMGPQLVVVGEEGFPDTGSDHSYSLSSGTTEEELLRKLNEQRDILALMEVKMKEMKGSIRHLRLTEAKLREELRE KDRLLAMAVIRKKHGM
Purity: >90% by SDS-PAGE
Applications: 1. Protein transduction for human HSC cell differentiation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production.
Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name: THAP11 THAP domain containing 11 [ Homo sapiens ]
Official Symbol: THAP11
Synonyms: THAP11; THAP domain containing 11; THAP domain-containing protein 11; CTG B43a; CTG B45d; HRIHFB2206; RONIN; CTG-B43a; CTG-B45d;
Gene ID: 57215
mRNA Refseq: NM_020457
Protein Refseq: NP_065190
MIM: 609119
UniProt ID: Q96EK4
Chromosome Location: 16q22.1
Function: DNA binding; metal ion binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.