Recombinant Human THAP11 protein, Arginine-tagged
Cat.No. : | THAP11-142H |
Product Overview : | Recombinant human THAP11 protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Form : | 0.40 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | GEFPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYT VRVPTIFPLRGVNERKVARRPAGAAAARRRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQSSPSASTAQTAQLQPN LVSASAAVLLTLQATVDSSQAPGSVQPAPITPTGEDVKPIDLTVQVEFAAAEGAAAAAAASELQAATAGLEAAEC PMGPQLVVVGEEGFPDTGSDHSYSLSSGTTEEELLRKLNEQRDILALMEVKMKEMKGSIRHLRLTEAKLREELRE KDRLLAMAVIRKKHGM |
Purity : | >90% by SDS-PAGE |
Applications : | 1. Protein transduction for human HSC cell differentiation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production. |
Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days. |
Gene Name | THAP11 THAP domain containing 11 [ Homo sapiens ] |
Official Symbol | THAP11 |
Synonyms | THAP11; THAP domain containing 11; THAP domain-containing protein 11; CTG B43a; CTG B45d; HRIHFB2206; RONIN; CTG-B43a; CTG-B45d; |
Gene ID | 57215 |
mRNA Refseq | NM_020457 |
Protein Refseq | NP_065190 |
MIM | 609119 |
UniProt ID | Q96EK4 |
Chromosome Location | 16q22.1 |
Function | DNA binding; metal ion binding; protein binding; |
◆ Recombinant Proteins | ||
THAP11-249H | Recombinant Human THAP11, His-tagged | +Inquiry |
THAP11-9177M | Recombinant Mouse THAP11 Protein, His (Fc)-Avi-tagged | +Inquiry |
THAP11-142H | Recombinant Human THAP11 protein, Arginine-tagged | +Inquiry |
THAP11-12326Z | Recombinant Zebrafish THAP11 | +Inquiry |
THAP11-16730M | Recombinant Mouse THAP11 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
THAP11-1771HCL | Recombinant Human THAP11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All THAP11 Products
Required fields are marked with *
My Review for All THAP11 Products
Required fields are marked with *
0
Inquiry Basket