Recombinant Human THAP11 protein, Arginine-tagged

• Cat.No.: THAP11-142H
• Product Overview: Recombinant human THAP11 protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Form: 0.40 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: GEFPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYT VRVPTIFPLRGVNERKVARRPAGAAAARRRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQSSPSASTAQTAQLQPN LVSASAAVLLTLQATVDSSQAPGSVQPAPITPTGEDVKPIDLTVQVEFAAAEGAAAAAAASELQAATAGLEAAEC PMGPQLVVVGEEGFPDTGSDHSYSLSSGTTEEELLRKLNEQRDILALMEVKMKEMKGSIRHLRLTEAKLREELRE KDRLLAMAVIRKKHGM
• Purity: >90% by SDS-PAGE
• Applications: 1. Protein transduction for human HSC cell differentiation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production.
• Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.

Gene Information

• Gene Name: THAP11 THAP domain containing 11 [ Homo sapiens ]
• Official Symbol: THAP11
• Synonyms: THAP11; THAP domain containing 11; THAP domain-containing protein 11; CTG B43a; CTG B45d; HRIHFB2206; RONIN; CTG-B43a; CTG-B45d
• Gene ID: 57215
• mRNA Refseq: NM_020457
• Protein Refseq: NP_065190
• MIM: 609119
• UniProt ID: Q96EK4
• Chromosome Location: 16q22.1
• Function: DNA binding; metal ion binding; protein binding