Recombinant Human THBS2 protein, His-tagged
| Cat.No. : | THBS2-3269H |
| Product Overview : | Recombinant Human THBS2 protein(19-100 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 25, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 19-100 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | GHQDKDTTFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNADDLSKITKIMRQKEGFFLTAQLKQDGKSRGTL |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | THBS2 thrombospondin 2 [ Homo sapiens ] |
| Official Symbol | THBS2 |
| Synonyms | THBS2; thrombospondin 2; thrombospondin-2; TSP2; |
| Gene ID | 7058 |
| mRNA Refseq | NM_003247 |
| Protein Refseq | NP_003238 |
| MIM | 188061 |
| UniProt ID | P35442 |
| ◆ Recombinant Proteins | ||
| THBS2-1539M | Recombinant Mouse THBS2 Protein (19-232 aa), His-tagged | +Inquiry |
| THBS2-1151C | Recombinant Chicken THBS2 | +Inquiry |
| THBS2-6444H | Recombinant Human THBS2 Protein (Asp968-Ile1172), N-His tagged | +Inquiry |
| Thbs2-8254M | Recombinant Mouse Thbs2 protein, His & GST-tagged | +Inquiry |
| Thbs2-1770R | Recombinant Rat Thbs2 protein, His & GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| THBS2-1100HCL | Recombinant Human THBS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All THBS2 Products
Required fields are marked with *
My Review for All THBS2 Products
Required fields are marked with *
