Recombinant Human thymosin beta 10 Protein, His-tagged

Cat.No. : TMSB10-01H
Product Overview : Recombinant Human TMSB10 Protein (2-44aa) with C-His-tag was expressed E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 2-44aa
Description : Predicted to enable actin monomer binding activity. Predicted to be involved in regulation of cell migration and sequestering of actin monomers. Predicted to be located in cytoskeleton. Predicted to be active in cytoplasm.
Tag : C-His
Molecular Mass : 6 kDa
AA Sequence : MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEISHHHHHHHHHH
Endotoxin : < 1 EU/μg by LAL.
Purity : > 90 % by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.5 mg/mL by BCA
Storage Buffer : Sterile PBS, pH7.4.
Gene Name TMSB10 thymosin beta 10 [Homo sapiens (human)]
Official Symbol TMSB10
Synonyms TMSB10; thymosin beta 10; thymosin beta-10; TB10; migration-inducing gene 12; migration-inducing protein 12; MIG12
Gene ID 9168
mRNA Refseq NM_021103
Protein Refseq NP_066926
MIM 188399
UniProt ID P63313

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMSB10 Products

Required fields are marked with *

My Review for All TMSB10 Products

Required fields are marked with *

0
cart-icon