Recombinant Human TIAF1 protein, GST-tagged
Cat.No. : | TIAF1-3581H |
Product Overview : | Recombinant Human TIAF1 protein(O95411)(1-115aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-115aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.4 kDa |
AA Sequence : | MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TIAF1 TGFB1-induced anti-apoptotic factor 1 [ Homo sapiens ] |
Official Symbol | TIAF1 |
Synonyms | TIAF1; TGFB1-induced anti-apoptotic factor 1; TGF-beta-1-induced antiapoptotic factor 1; molecule associated with Jak-3 N-terminal; 12 kDa TGF-beta-1-induced antiapoptotic factor; MAJN; SPR210; |
Gene ID | 9220 |
mRNA Refseq | NM_004740 |
Protein Refseq | NP_004731 |
MIM | 609517 |
UniProt ID | O95411 |
◆ Recombinant Proteins | ||
TIAF1-3581H | Recombinant Human TIAF1 protein, GST-tagged | +Inquiry |
TIAF1-7137H | Recombinant Human TGFB1-Induced Anti-Apoptotic Factor 1, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TIAF1 Products
Required fields are marked with *
My Review for All TIAF1 Products
Required fields are marked with *
0
Inquiry Basket