Recombinant Human TICAM1 protein, His-tagged
| Cat.No. : | TICAM1-3257H |
| Product Overview : | Recombinant Human TICAM1 protein(1-143 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-143 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MACTGPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARISLEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVAYQEAVRTLSSRDDHRLGELQDEARNR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | TICAM1 toll-like receptor adaptor molecule 1 [ Homo sapiens ] |
| Official Symbol | TICAM1 |
| Synonyms | TICAM1; toll-like receptor adaptor molecule 1; TIR domain-containing adapter molecule 1; MGC35334; PRVTIRB; TICAM 1; TRIF; putative NF-kappa-B-activating protein 502H; TIR domain containing adaptor inducing interferon-beta; TIR domain-containing adapter protein inducing IFN-beta; proline-rich, vinculin and TIR domain-containing protein B; toll-interleukin-1 receptor domain-containing adapter protein inducing interferon beta; TICAM-1; |
| Gene ID | 148022 |
| mRNA Refseq | NM_182919 |
| Protein Refseq | NP_891549 |
| MIM | 607601 |
| UniProt ID | Q8IUC6 |
| ◆ Recombinant Proteins | ||
| TICAM1-3657C | Recombinant Chicken TICAM1 | +Inquiry |
| TICAM1-1021C | Recombinant Cynomolgus TICAM1 Protein, His-tagged | +Inquiry |
| TICAM1-3257H | Recombinant Human TICAM1 protein, His-tagged | +Inquiry |
| TICAM1-2446H | Recombinant Human TICAM1 protein, His-tagged | +Inquiry |
| TICAM1-301439H | Recombinant Human TICAM1 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TICAM1-1080HCL | Recombinant Human TICAM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TICAM1 Products
Required fields are marked with *
My Review for All TICAM1 Products
Required fields are marked with *
