Recombinant Human TIMP4 protein, GST-tagged
Cat.No. : | TIMP4-3111H |
Product Overview : | Recombinant Human TIMP4 protein(116-175 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 116-175 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | LTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNE |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | TIMP4 TIMP metallopeptidase inhibitor 4 [ Homo sapiens ] |
Official Symbol | TIMP4 |
Synonyms | TIMP4; TIMP metallopeptidase inhibitor 4; tissue inhibitor of metalloproteinase 4; metalloproteinase inhibitor 4; TIMP-4; tissue inhibitor of metalloproteinases 4; |
mRNA Refseq | NM_003256 |
Protein Refseq | NP_003247 |
MIM | 601915 |
UniProt ID | Q99727 |
Gene ID | 7079 |
◆ Recombinant Proteins | ||
TIMP4-4538R | Recombinant Rhesus Macaque TIMP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
TIMP4-3243H | Active Recombinant Human TIMP4, MIgG2a Fc-tagged | +Inquiry |
Timp4-5644M | Recombinant Mouse Timp4 protein, His-SUMO-tagged | +Inquiry |
Timp4-550M | Recombinant Mouse Timp4 protein, His-tagged | +Inquiry |
TIMP4-3244H | Active Recombinant Human TIMP4, HIgG1 Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIMP4-1063HCL | Recombinant Human TIMP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TIMP4 Products
Required fields are marked with *
My Review for All TIMP4 Products
Required fields are marked with *
0
Inquiry Basket