Recombinant Human TIMP4 protein, GST-tagged
| Cat.No. : | TIMP4-3111H |
| Product Overview : | Recombinant Human TIMP4 protein(116-175 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 116-175 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | LTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNE |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | TIMP4 TIMP metallopeptidase inhibitor 4 [ Homo sapiens ] |
| Official Symbol | TIMP4 |
| Synonyms | TIMP4; TIMP metallopeptidase inhibitor 4; tissue inhibitor of metalloproteinase 4; metalloproteinase inhibitor 4; TIMP-4; tissue inhibitor of metalloproteinases 4; |
| mRNA Refseq | NM_003256 |
| Protein Refseq | NP_003247 |
| MIM | 601915 |
| UniProt ID | Q99727 |
| Gene ID | 7079 |
| ◆ Recombinant Proteins | ||
| TIMP4-4002H | Recombinant Human TIMP4 protein, His-tagged | +Inquiry |
| TIMP4-6458H | Recombinant Human TIMP4 Protein (Cys32-Pro224), His tagged | +Inquiry |
| TIMP4-3584B | Active Recombinant Bovine TIMP4 protein, His-tagged | +Inquiry |
| TIMP4-1541B | Recombinant Bovine TIMP4 Protein (30-224 aa), His-tagged | +Inquiry |
| TIMP4-26H | Recombinant Human TIMP4 protein, Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TIMP4-1063HCL | Recombinant Human TIMP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TIMP4 Products
Required fields are marked with *
My Review for All TIMP4 Products
Required fields are marked with *
