Recombinant Human TLE4 protein, His-tagged
Cat.No. : | TLE4-938H |
Product Overview : | Recombinant Human TLE4 protein(NP_001269677)(173-243 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 173-243 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SSALGGQSHLPIKDEKKHHDNDHQRDRDSIKSSSVSPSASFRGAEKHRNSADYSSESKKQKTEEKEIAARY |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TLE4 TLE family member 4, transcriptional corepressor [ Homo sapiens (human) ] |
Official Symbol | TLE4 |
Synonyms | ESG; BCE1; ESG4; GRG4; BCE-1; Grg-4; E(spI); E(spl) |
Gene ID | 7091 |
mRNA Refseq | NM_001282748 |
Protein Refseq | NP_001269677 |
MIM | 605132 |
UniProt ID | Q04727 |
◆ Recombinant Proteins | ||
TLE4-3251H | Recombinant Human TLE4, GST-tagged | +Inquiry |
TLE4-938H | Recombinant Human TLE4 protein, His-tagged | +Inquiry |
TLE4-16815M | Recombinant Mouse TLE4 Protein | +Inquiry |
TLE4-5810C | Recombinant Chicken TLE4 | +Inquiry |
TLE4-9233M | Recombinant Mouse TLE4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TLE4-1785HCL | Recombinant Human TLE4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TLE4 Products
Required fields are marked with *
My Review for All TLE4 Products
Required fields are marked with *
0
Inquiry Basket