Recombinant Human TLR10 protein, His-tagged
Cat.No. : | TLR10-2399H |
Product Overview : | Recombinant Human TLR10 protein(Q9BXR5)(20-576aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 20-576aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 68.1 kDa |
AA Sequence : | DAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLRYLDLSFNDFDTMPICEEAGNMSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGFRTLPHYEEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLENAKTSVLLLNKVDLLWDDLFLILQFVWHTSVEHFQIRNVTFGGKAYLDHNSFDYSNTVMRTIKLEHVHFRVFYIQQDKIYLLLTKMDIENLTISNAQMPHMLFPNYPTKFQYLNFANNILTDELFKRTIQLPHLKTLILNGNKLETLSLVSCFANNTPLEHLDLSQNLLQHKNDENCSWPETVVNMNLSYNKLSDSVFRCLPKSIQILDLNNNQIQTVPKETIHLMALRELNIAFNFLTDLPGCSHFSRLSVLNIEMNFILSPSLDFVQSCQEVKTLNAGRNPFRCTCELKNFIQLETYSEVMMVGWSDSYTCEYPLNLRGTRLKDVHLHELSCNT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TLR10 toll-like receptor 10 [ Homo sapiens ] |
Official Symbol | TLR10 |
Synonyms | TLR10; toll-like receptor 10; CD290; MGC104967; MGC126398; MGC126399; |
Gene ID | 81793 |
mRNA Refseq | NM_001017388 |
Protein Refseq | NP_001017388 |
MIM | 606270 |
UniProt ID | Q9BXR5 |
◆ Recombinant Proteins | ||
TLR10-2399H | Recombinant Human TLR10 protein, His-tagged | +Inquiry |
TLR10-2080H | Recombinant Human TLR10 protein, His & GST-tagged | +Inquiry |
TLR10-1476H | Recombinant Human TLR10 Protein (Lys622-Asn776), N-His tagged | +Inquiry |
TLR10-5197H | Recombinant Human TLR10 Protein (Met1-Thr576), C-His tagged | +Inquiry |
TLR10-2400H | Recombinant Human TLR10 protein, His-SUMO & Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TLR10-1046HCL | Recombinant Human TLR10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TLR10 Products
Required fields are marked with *
My Review for All TLR10 Products
Required fields are marked with *
0
Inquiry Basket