Recombinant Human TMEM106B protein, His-tagged
Cat.No. : | TMEM106B-4690H |
Product Overview : | Recombinant Human TMEM106B protein(Q9NUM4)(120-254 aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 120-254 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 17.0 kDa |
AASequence : | SIDVKYIGVKSAYVSYDVQKRTIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITIIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLISIKVHNIVLMMQVTVTTTYFGHSEQISQERYQYVDCG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
◆ Recombinant Proteins | ||
TMEM106B-4760R | Recombinant Rhesus monkey TMEM106B Protein, His-tagged | +Inquiry |
TMEM106B-33H | Recombinant Human TMEM106B Protein, GST-tagged | +Inquiry |
TMEM106B-4574R | Recombinant Rhesus Macaque TMEM106B Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM106B-1930C | Recombinant Chicken TMEM106B | +Inquiry |
TMEM106B-5764R | Recombinant Rat TMEM106B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM106B-1016HCL | Recombinant Human TMEM106B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM106B Products
Required fields are marked with *
My Review for All TMEM106B Products
Required fields are marked with *