Recombinant Mouse Tmem106b protein, His-tagged
Cat.No. : | Tmem106b-4656M |
Product Overview : | Recombinant Mouse Tmem106b protein(Q80X71)(119-275aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 119-275aa |
Tag : | C-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.6 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | PRSIEVKYIGVKSAYVSYDAEKRTIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITNIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLLSIKVHNIVLMMQVTVTTAYFGHSEQISQERYQYVDCGRNTTYQLAQSEYLNVLQPQQ |
◆ Recombinant Proteins | ||
TMEM106B-3274H | Recombinant Human TMEM106B, GST-tagged | +Inquiry |
Tmem106b-4656M | Recombinant Mouse Tmem106b protein, His-tagged | +Inquiry |
TMEM106B-4574R | Recombinant Rhesus Macaque TMEM106B Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM106B-4760R | Recombinant Rhesus monkey TMEM106B Protein, His-tagged | +Inquiry |
TMEM106B-6107R | Recombinant Rat TMEM106B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM106B-1016HCL | Recombinant Human TMEM106B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tmem106b Products
Required fields are marked with *
My Review for All Tmem106b Products
Required fields are marked with *
0
Inquiry Basket