Recombinant Human TMEM106B, GST-tagged
| Cat.No. : | TMEM106B-3274H |
| Product Overview : | Recombinant Human TMEM106B(150-274 aa), fused with a GST tag at the N-terminus, was expressed in E. coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 150-274 aa |
| Form : | Lyophilized from sterile PBS, pH7.4, 0.3% SKL, 5% Trehalose, 5% Mannitol. |
| Molecular Mass : | The protein has a calculated MW of 40.72 kDa. |
| Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
| Purity : | > 90 % as determined by SDS-PAGE. |
| Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.86mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITIIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLISIKVHNIVLMMQVTVTTTYFGHSEQISQERYQYVDCGRNTTYQLGQSEYLNVLQPQQ |
| Official Symbol | TMEM106B |
| ◆ Recombinant Proteins | ||
| TMEM106B-6107R | Recombinant Rat TMEM106B Protein | +Inquiry |
| TMEM106B-33H | Recombinant Human TMEM106B Protein, GST-tagged | +Inquiry |
| TMEM106B-5764R | Recombinant Rat TMEM106B Protein, His (Fc)-Avi-tagged | +Inquiry |
| TMEM106B-4690H | Recombinant Human TMEM106B protein, His-tagged | +Inquiry |
| TMEM106B-3274H | Recombinant Human TMEM106B, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TMEM106B-1016HCL | Recombinant Human TMEM106B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (1)
- Q&As (0)
Customer Reviews
Write a reviewReviews
06/11/2024
It took a while for us to test it but it looks to be working well for us. We would definitely like to purchase more.
Ask a Question for All TMEM106B Products
Required fields are marked with *
My Review for All TMEM106B Products
Required fields are marked with *
